diff options
authorGravatar Hanspeter Portner <dev@open-music-kontrollers.ch>2019-03-16 16:55:40 +0100
committerGravatar Hanspeter Portner <dev@open-music-kontrollers.ch>2019-03-16 16:55:40 +0100
commitf4d902d6a016f9d25f45cca7bb9b1c876a0864e9 (patch)
parentc37cce9d075cb1eb6691244cf25121ddea438f3b (diff)
parent2462d1c890de3a577f278795029a40399d72db8e (diff)
Merge commit '2462d1c890de3a577f278795029a40399d72db8e' as 'subprojects/d2tk'
-rw-r--r--subprojects/d2tk/example/libre-arrow-circle-right.pngbin0 -> 2133 bytes
-rw-r--r--subprojects/d2tk/example/libre-gui-file.pngbin0 -> 1034 bytes
-rw-r--r--subprojects/d2tk/example/libre-gui-folder.pngbin0 -> 710 bytes
-rw-r--r--subprojects/d2tk/nanovg/example/NotoEmoji-Regular.ttfbin0 -> 418804 bytes
-rwxr-xr-xsubprojects/d2tk/nanovg/example/Roboto-Bold.ttfbin0 -> 135820 bytes
-rwxr-xr-xsubprojects/d2tk/nanovg/example/Roboto-Light.ttfbin0 -> 140276 bytes
-rwxr-xr-xsubprojects/d2tk/nanovg/example/Roboto-Regular.ttfbin0 -> 145348 bytes
-rw-r--r--subprojects/d2tk/nanovg/example/entypo.ttfbin0 -> 35392 bytes
-rw-r--r--subprojects/d2tk/nanovg/example/images/image1.jpgbin0 -> 25760 bytes
-rw-r--r--subprojects/d2tk/nanovg/example/images/image10.jpgbin0 -> 3439 bytes
-rw-r--r--subprojects/d2tk/nanovg/example/images/image11.jpgbin0 -> 3818 bytes
-rw-r--r--subprojects/d2tk/nanovg/example/images/image12.jpgbin0 -> 5452 bytes
-rw-r--r--subprojects/d2tk/nanovg/example/images/image2.jpgbin0 -> 24091 bytes
-rw-r--r--subprojects/d2tk/nanovg/example/images/image3.jpgbin0 -> 29282 bytes
-rw-r--r--subprojects/d2tk/nanovg/example/images/image4.jpgbin0 -> 23830 bytes
-rw-r--r--subprojects/d2tk/nanovg/example/images/image5.jpgbin0 -> 27131 bytes
-rw-r--r--subprojects/d2tk/nanovg/example/images/image6.jpgbin0 -> 25116 bytes
-rw-r--r--subprojects/d2tk/nanovg/example/images/image7.jpgbin0 -> 25590 bytes
-rw-r--r--subprojects/d2tk/nanovg/example/images/image8.jpgbin0 -> 24607 bytes
-rw-r--r--subprojects/d2tk/nanovg/example/images/image9.jpgbin0 -> 4035 bytes
-rw-r--r--subprojects/d2tk/nanovg/example/screenshot-01.pngbin0 -> 989424 bytes
-rw-r--r--subprojects/d2tk/nanovg/example/screenshot-02.pngbin0 -> 229443 bytes
-rwxr-xr-xsubprojects/d2tk/pugl/wafbin0 -> 97489 bytes
-rw-r--r--subprojects/d2tk/screenshots/screenshot_1.pngbin0 -> 149120 bytes
-rw-r--r--subprojects/d2tk/screenshots/screenshot_2.pngbin0 -> 37532 bytes
-rw-r--r--subprojects/d2tk/screenshots/screenshot_3.pngbin0 -> 128486 bytes
-rw-r--r--subprojects/d2tk/screenshots/screenshot_4.pngbin0 -> 35888 bytes
-rw-r--r--subprojects/d2tk/screenshots/screenshot_5.pngbin0 -> 51888 bytes
-rw-r--r--subprojects/d2tk/screenshots/screenshot_6.pngbin0 -> 84697 bytes
-rw-r--r--subprojects/d2tk/screenshots/screenshot_7.pngbin0 -> 42476 bytes
-rw-r--r--subprojects/d2tk/screenshots/screenshot_8.pngbin0 -> 73108 bytes
113 files changed, 103553 insertions, 0 deletions
diff --git a/subprojects/d2tk/.gitignore b/subprojects/d2tk/.gitignore
new file mode 100644
index 0000000..651404e
--- /dev/null
+++ b/subprojects/d2tk/.gitignore
@@ -0,0 +1,4 @@
diff --git a/subprojects/d2tk/.gitlab-ci.yml b/subprojects/d2tk/.gitlab-ci.yml
new file mode 100644
index 0000000..48c411c
--- /dev/null
+++ b/subprojects/d2tk/.gitlab-ci.yml
@@ -0,0 +1,97 @@
+ - build
+ - deploy
+.variables_template: &variables_definition
+ variables:
+ BASE_NAME: "d2tk"
+ PKG_CONFIG_PATH: "/opt/lv2/lib/pkgconfig:/opt/${CI_BUILD_NAME}/lib/pkgconfig:/usr/lib/${CI_BUILD_NAME}/pkgconfig"
+.common_template: &common_definition
+ <<: *variables_definition
+ stage: build
+ artifacts:
+ name: "${BASE_NAME}-$(cat VERSION)-${CI_BUILD_NAME}"
+ paths:
+ - "${BASE_NAME}-$(cat VERSION)/"
+.build_template: &build_definition
+ <<: *common_definition
+ script:
+ - meson --prefix="/" --libdir="lib" --cross-file "${CI_BUILD_NAME}" -Db_lto=false build
+ - sed -i -e '/framework/s/-Wl,-O1//g' -e '/framework/s/-Wl,--start-group//g' -e '/framework/s/-Wl,--end-group//g' build/build.ninja
+ - ninja -C build
+ - DESTDIR="${CI_PROJECT_DIR}/${BASE_NAME}-$(cat VERSION)/${CI_BUILD_NAME}" ninja -C build install
+.test_template: &test_definition
+ <<: *common_definition
+ script:
+ - meson --prefix="/" --libdir="lib" --cross-file "${CI_BUILD_NAME}" -Db_lto=false build
+ - sed -i -e '/framework/s/-Wl,-O1//g' -e '/framework/s/-Wl,--start-group//g' -e '/framework/s/-Wl,--end-group//g' build/build.ninja
+ - ninja -C build
+ - DESTDIR="${CI_PROJECT_DIR}/${BASE_NAME}-$(cat VERSION)/${CI_BUILD_NAME}" ninja -C build install
+ - ninja -C build test
+.universal_linux_template: &universal_linux_definition
+ image: ventosus/universal-linux-gnu
+ <<: *test_definition
+.arm_linux_template: &arm_linux_definition
+ image: ventosus/arm-linux-gnueabihf
+ <<: *test_definition
+.universal_w64_template: &universal_w64_definition
+ image: ventosus/universal-w64-mingw32
+ <<: *build_definition
+.universal_apple_template: &universal_apple_definition
+ image: ventosus/universal-apple-darwin
+ <<: *test_definition
+# building in docker
+ before_script:
+ - apt-get install -y libglu1-mesa-dev libevdev-dev
+ <<: *universal_linux_definition
+ before_script:
+ - apt-get install -y libglu1-mesa-dev:i386 libevdev-dev:i386
+ <<: *universal_linux_definition
+ before_script:
+ - apt-get install -y libglu1-mesa-dev:armhf libevdev-dev:armhf
+ <<: *arm_linux_definition
+ <<: *universal_w64_definition
+ <<: *universal_w64_definition
+ <<: *universal_apple_definition
+ <<: *variables_definition
+ stage: deploy
+ script:
+ - echo 'packing up...'
+ artifacts:
+ name: "${BASE_NAME}-$(cat VERSION)"
+ paths:
+ - "${BASE_NAME}-$(cat VERSION)/"
+ <<: *variables_definition
+ stage: deploy
+ before_script:
+ - apt-get update -y
+ - apt-get install -y doxygen
+ script:
+ - doxygen
+ - cp -r doc/html public
+ artifacts:
+ paths:
+ - public/
diff --git a/subprojects/d2tk/COPYING b/subprojects/d2tk/COPYING
new file mode 100644
index 0000000..ddb9a46
--- /dev/null
+++ b/subprojects/d2tk/COPYING
@@ -0,0 +1,201 @@
+ The Artistic License 2.0
+ Copyright (c) 2000-2006, The Perl Foundation.
+ Everyone is permitted to copy and distribute verbatim copies
+ of this license document, but changing it is not allowed.
+This license establishes the terms under which a given free software
+Package may be copied, modified, distributed, and/or redistributed.
+The intent is that the Copyright Holder maintains some artistic
+control over the development of that Package while still keeping the
+Package available as open source and free software.
+You are always permitted to make arrangements wholly outside of this
+license directly with the Copyright Holder of a given Package. If the
+terms of this license do not permit the full use that you propose to
+make of the Package, you should contact the Copyright Holder and seek
+a different licensing arrangement.
+ "Copyright Holder" means the individual(s) or organization(s)
+ named in the copyright notice for the entire Package.
+ "Contributor" means any party that has contributed code or other
+ material to the Package, in accordance with the Copyright Holder's
+ procedures.
+ "You" and "your" means any person who would like to copy,
+ distribute, or modify the Package.
+ "Package" means the collection of files distributed by the
+ Copyright Holder, and derivatives of that collection and/or of
+ those files. A given Package may consist of either the Standard
+ Version, or a Modified Version.
+ "Distribute" means providing a copy of the Package or making it
+ accessible to anyone else, or in the case of a company or
+ organization, to others outside of your company or organization.
+ "Distributor Fee" means any fee that you charge for Distributing
+ this Package or providing support for this Package to another
+ party. It does not mean licensing fees.
+ "Standard Version" refers to the Package if it has not been
+ modified, or has been modified only in ways explicitly requested
+ by the Copyright Holder.
+ "Modified Version" means the Package, if it has been changed, and
+ such changes were not explicitly requested by the Copyright
+ Holder.
+ "Original License" means this Artistic License as Distributed with
+ the Standard Version of the Package, in its current version or as
+ it may be modified by The Perl Foundation in the future.
+ "Source" form means the source code, documentation source, and
+ configuration files for the Package.
+ "Compiled" form means the compiled bytecode, object code, binary,
+ or any other form resulting from mechanical transformation or
+ translation of the Source form.
+Permission for Use and Modification Without Distribution
+(1) You are permitted to use the Standard Version and create and use
+Modified Versions for any purpose without restriction, provided that
+you do not Distribute the Modified Version.
+Permissions for Redistribution of the Standard Version
+(2) You may Distribute verbatim copies of the Source form of the
+Standard Version of this Package in any medium without restriction,
+either gratis or for a Distributor Fee, provided that you duplicate
+all of the original copyright notices and associated disclaimers. At
+your discretion, such verbatim copies may or may not include a
+Compiled form of the Package.
+(3) You may apply any bug fixes, portability changes, and other
+modifications made available from the Copyright Holder. The resulting
+Package will still be considered the Standard Version, and as such
+will be subject to the Original License.
+Distribution of Modified Versions of the Package as Source
+(4) You may Distribute your Modified Version as Source (either gratis
+or for a Distributor Fee, and with or without a Compiled form of the
+Modified Version) provided that you clearly document how it differs
+from the Standard Version, including, but not limited to, documenting
+any non-standard features, executables, or modules, and provided that
+you do at least ONE of the following:
+ (a) make the Modified Version available to the Copyright Holder
+ of the Standard Version, under the Original License, so that the
+ Copyright Holder may include your modifications in the Standard
+ Version.
+ (b) ensure that installation of your Modified Version does not
+ prevent the user installing or running the Standard Version. In
+ addition, the Modified Version must bear a name that is different
+ from the name of the Standard Version.
+ (c) allow anyone who receives a copy of the Modified Version to
+ make the Source form of the Modified Version available to others
+ under
+ (i) the Original License or
+ (ii) a license that permits the licensee to freely copy,
+ modify and redistribute the Modified Version using the same
+ licensing terms that apply to the copy that the licensee
+ received, and requires that the Source form of the Modified
+ Version, and of any works derived from it, be made freely
+ available in that license fees are prohibited but Distributor
+ Fees are allowed.
+Distribution of Compiled Forms of the Standard Version
+or Modified Versions without the Source
+(5) You may Distribute Compiled forms of the Standard Version without
+the Source, provided that you include complete instructions on how to
+get the Source of the Standard Version. Such instructions must be
+valid at the time of your distribution. If these instructions, at any
+time while you are carrying out such distribution, become invalid, you
+must provide new instructions on demand or cease further distribution.
+If you provide valid instructions or cease distribution within thirty
+days after you become aware that the instructions are invalid, then
+you do not forfeit any of your rights under this license.
+(6) You may Distribute a Modified Version in Compiled form without
+the Source, provided that you comply with Section 4 with respect to
+the Source of the Modified Version.
+Aggregating or Linking the Package
+(7) You may aggregate the Package (either the Standard Version or
+Modified Version) with other packages and Distribute the resulting
+aggregation provided that you do not charge a licensing fee for the
+Package. Distributor Fees are permitted, and licensing fees for other
+components in the aggregation are permitted. The terms of this license
+apply to the use and Distribution of the Standard or Modified Versions
+as included in the aggregation.
+(8) You are permitted to link Modified and Standard Versions with
+other works, to embed the Package in a larger work of your own, or to
+build stand-alone binary or bytecode versions of applications that
+include the Package, and Distribute the result without restriction,
+provided the result does not expose a direct interface to the Package.
+Items That are Not Considered Part of a Modified Version
+(9) Works (including, but not limited to, modules and scripts) that
+merely extend or make use of the Package, do not, by themselves, cause
+the Package to be a Modified Version. In addition, such works are not
+considered parts of the Package itself, and are not subject to the
+terms of this license.
+General Provisions
+(10) Any use, modification, and distribution of the Standard or
+Modified Versions is governed by this Artistic License. By using,
+modifying or distributing the Package, you accept this license. Do not
+use, modify, or distribute the Package, if you do not accept this
+(11) If your Modified Version has been derived from a Modified
+Version made by someone other than you, you are nevertheless required
+to ensure that your Modified Version complies with the requirements of
+this license.
+(12) This license does not grant you the right to use any trademark,
+service mark, tradename, or logo of the Copyright Holder.
+(13) This license includes the non-exclusive, worldwide,
+free-of-charge patent license to make, have made, use, offer to sell,
+sell, import and otherwise transfer the Package with respect to any
+patent claims licensable by the Copyright Holder that are necessarily
+infringed by the Package. If you institute patent litigation
+(including a cross-claim or counterclaim) against any party alleging
+that the Package constitutes direct or contributory patent
+infringement, then this Artistic License to you shall terminate on the
+date that such litigation is filed.
+(14) Disclaimer of Warranty:
diff --git a/subprojects/d2tk/Doxyfile b/subprojects/d2tk/Doxyfile
new file mode 100644
index 0000000..294d19d
--- /dev/null
+++ b/subprojects/d2tk/Doxyfile
@@ -0,0 +1,2482 @@
+# Doxyfile 1.8.14
+# This file describes the settings to be used by the documentation system
+# doxygen (www.doxygen.org) for a project.
+# All text after a double hash (##) is considered a comment and is placed in
+# front of the TAG it is preceding.
+# All text after a single hash (#) is considered a comment and will be ignored.
+# The format is:
+# TAG = value [value, ...]
+# For lists, items can also be appended using:
+# TAG += value [value, ...]
+# Values that contain spaces should be placed between quotes (\" \").
+# Project related configuration options
+# This tag specifies the encoding used for all characters in the config file
+# that follow. The default is UTF-8 which is also the encoding used for all text
+# before the first occurrence of this tag. Doxygen uses libiconv (or the iconv
+# built into libc) for the transcoding. See
+# https://www.gnu.org/software/libiconv/ for the list of possible encodings.
+# The default value is: UTF-8.
+# The PROJECT_NAME tag is a single word (or a sequence of words surrounded by
+# double-quotes, unless you are using Doxywizard) that should identify the
+# project for which the documentation is generated. This name is used in the
+# title of most generated pages and in a few other places.
+# The default value is: My Project.
+# The PROJECT_NUMBER tag can be used to enter a project or revision number. This
+# could be handy for archiving the generated documentation or if some version
+# control system is used.
+# Using the PROJECT_BRIEF tag one can provide an optional one line description
+# for a project that appears at the top of each page and should give viewer a
+# quick idea about the purpose of the project. Keep the description short.
+PROJECT_BRIEF = "Data Driven Tool Kit"
+# With the PROJECT_LOGO tag one can specify a logo or an icon that is included
+# in the documentation. The maximum height of the logo should not exceed 55
+# pixels and the maximum width should not exceed 200 pixels. Doxygen will copy
+# the logo to the output directory.
+# The OUTPUT_DIRECTORY tag is used to specify the (relative or absolute) path
+# into which the generated documentation will be written. If a relative path is
+# entered, it will be relative to the location where doxygen was started. If
+# left blank the current directory will be used.
+# If the CREATE_SUBDIRS tag is set to YES then doxygen will create 4096 sub-
+# directories (in 2 levels) under the output directory of each output format and
+# will distribute the generated files over these directories. Enabling this
+# option can be useful when feeding doxygen a huge amount of source files, where
+# putting all generated files in the same directory would otherwise causes
+# performance problems for the file system.
+# The default value is: NO.
+# If the ALLOW_UNICODE_NAMES tag is set to YES, doxygen will allow non-ASCII
+# characters to appear in the names of generated files. If set to NO, non-ASCII
+# characters will be escaped, for example _xE3_x81_x84 will be used for Unicode
+# U+3044.
+# The default value is: NO.
+# The OUTPUT_LANGUAGE tag is used to specify the language in which all
+# documentation generated by doxygen is written. Doxygen will use this
+# information to generate all constant output in the proper language.
+# Possible values are: Afrikaans, Arabic, Armenian, Brazilian, Catalan, Chinese,
+# Chinese-Traditional, Croatian, Czech, Danish, Dutch, English (United States),
+# Esperanto, Farsi (Persian), Finnish, French, German, Greek, Hungarian,
+# Indonesian, Italian, Japanese, Japanese-en (Japanese with English messages),
+# Korean, Korean-en (Korean with English messages), Latvian, Lithuanian,
+# Macedonian, Norwegian, Persian (Farsi), Polish, Portuguese, Romanian, Russian,
+# Serbian, Serbian-Cyrillic, Slovak, Slovene, Spanish, Swedish, Turkish,
+# Ukrainian and Vietnamese.
+# The default value is: English.
+# If the BRIEF_MEMBER_DESC tag is set to YES, doxygen will include brief member
+# descriptions after the members that are listed in the file and class
+# documentation (similar to Javadoc). Set to NO to disable this.
+# The default value is: YES.
+# If the REPEAT_BRIEF tag is set to YES, doxygen will prepend the brief
+# description of a member or function before the detailed description
+# Note: If both HIDE_UNDOC_MEMBERS and BRIEF_MEMBER_DESC are set to NO, the
+# brief descriptions will be completely suppressed.
+# The default value is: YES.
+# This tag implements a quasi-intelligent brief description abbreviator that is
+# used to form the text in various listings. Each string in this list, if found
+# as the leading text of the brief description, will be stripped from the text
+# and the result, after processing the whole list, is used as the annotated
+# text. Otherwise, the brief description is used as-is. If left blank, the
+# following values are used ($name is automatically replaced with the name of
+# the entity):The $name class, The $name widget, The $name file, is, provides,
+# specifies, contains, represents, a, an and the.
+ABBREVIATE_BRIEF = "The $name class" \
+ "The $name widget" \
+ "The $name file" \
+ is \
+ provides \
+ specifies \
+ contains \
+ represents \
+ a \
+ an \
+ the
+# If the ALWAYS_DETAILED_SEC and REPEAT_BRIEF tags are both set to YES then
+# doxygen will generate a detailed section even if there is only a brief
+# description.
+# The default value is: NO.
+# If the INLINE_INHERITED_MEMB tag is set to YES, doxygen will show all
+# inherited members of a class in the documentation of that class as if those
+# members were ordinary class members. Constructors, destructors and assignment
+# operators of the base classes will not be shown.
+# The default value is: NO.
+# If the FULL_PATH_NAMES tag is set to YES, doxygen will prepend the full path
+# before files name in the file list and in the header files. If set to NO the
+# shortest path that makes the file name unique will be used
+# The default value is: YES.
+# The STRIP_FROM_PATH tag can be used to strip a user-defined part of the path.
+# Stripping is only done if one of the specified strings matches the left-hand
+# part of the path. The tag can be used to show relative paths in the file list.
+# If left blank the directory from which doxygen is run is used as the path to
+# strip.
+# Note that you can specify absolute paths here, but also relative paths, which
+# will be relative from the directory where doxygen is started.
+# This tag requires that the tag FULL_PATH_NAMES is set to YES.
+# The STRIP_FROM_INC_PATH tag can be used to strip a user-defined part of the
+# path mentioned in the documentation of a class, which tells the reader which
+# header file to include in order to use a class. If left blank only the name of
+# the header file containing the class definition is used. Otherwise one should
+# specify the list of include paths that are normally passed to the compiler
+# using the -I flag.
+# If the SHORT_NAMES tag is set to YES, doxygen will generate much shorter (but
+# less readable) file names. This can be useful is your file systems doesn't
+# support long names like on DOS, Mac, or CD-ROM.
+# The default value is: NO.
+# If the JAVADOC_AUTOBRIEF tag is set to YES then doxygen will interpret the
+# first line (until the first dot) of a Javadoc-style comment as the brief
+# description. If set to NO, the Javadoc-style will behave just like regular Qt-
+# style comments (thus requiring an explicit @brief command for a brief
+# description.)
+# The default value is: NO.
+# If the QT_AUTOBRIEF tag is set to YES then doxygen will interpret the first
+# line (until the first dot) of a Qt-style comment as the brief description. If
+# set to NO, the Qt-style will behave just like regular Qt-style comments (thus
+# requiring an explicit \brief command for a brief description.)
+# The default value is: NO.
+# The MULTILINE_CPP_IS_BRIEF tag can be set to YES to make doxygen treat a
+# multi-line C++ special comment block (i.e. a block of //! or /// comments) as
+# a brief description. This used to be the default behavior. The new default is
+# to treat a multi-line C++ comment block as a detailed description. Set this
+# tag to YES if you prefer the old behavior instead.
+# Note that setting this tag to YES also means that rational rose comments are
+# not recognized any more.
+# The default value is: NO.
+# If the INHERIT_DOCS tag is set to YES then an undocumented member inherits the
+# documentation from any documented member that it re-implements.
+# The default value is: YES.
+# If the SEPARATE_MEMBER_PAGES tag is set to YES then doxygen will produce a new
+# page for each member. If set to NO, the documentation of a member will be part
+# of the file/class/namespace that contains it.
+# The default value is: NO.
+# The TAB_SIZE tag can be used to set the number of spaces in a tab. Doxygen
+# uses this value to replace tabs by spaces in code fragments.
+# Minimum value: 1, maximum value: 16, default value: 4.
+# This tag can be used to specify a number of aliases that act as commands in
+# the documentation. An alias has the form:
+# name=value
+# For example adding
+# "sideeffect=@par Side Effects:\n"
+# will allow you to put the command \sideeffect (or @sideeffect) in the
+# documentation, which will result in a user-defined paragraph with heading
+# "Side Effects:". You can put \n's in the value part of an alias to insert
+# newlines (in the resulting output). You can put ^^ in the value part of an
+# alias to insert a newline as if a physical newline was in the original file.
+# This tag can be used to specify a number of word-keyword mappings (TCL only).
+# A mapping has the form "name=value". For example adding "class=itcl::class"
+# will allow you to use the command class in the itcl::class meaning.
+# Set the OPTIMIZE_OUTPUT_FOR_C tag to YES if your project consists of C sources
+# only. Doxygen will then generate output that is more tailored for C. For
+# instance, some of the names that are used will be different. The list of all
+# members will be omitted, etc.
+# The default value is: NO.
+# Set the OPTIMIZE_OUTPUT_JAVA tag to YES if your project consists of Java or
+# Python sources only. Doxygen will then generate output that is more tailored
+# for that language. For instance, namespaces will be presented as packages,
+# qualified scopes will look different, etc.
+# The default value is: NO.
+# Set the OPTIMIZE_FOR_FORTRAN tag to YES if your project consists of Fortran
+# sources. Doxygen will then generate output that is tailored for Fortran.
+# The default value is: NO.
+# Set the OPTIMIZE_OUTPUT_VHDL tag to YES if your project consists of VHDL
+# sources. Doxygen will then generate output that is tailored for VHDL.
+# The default value is: NO.
+# Doxygen selects the parser to use depending on the extension of the files it
+# parses. With this tag you can assign which parser to use for a given
+# extension. Doxygen has a built-in mapping, but you can override or extend it
+# using this tag. The format is ext=language, where ext is a file extension, and
+# language is one of the parsers supported by doxygen: IDL, Java, Javascript,
+# C#, C, C++, D, PHP, Objective-C, Python, Fortran (fixed format Fortran:
+# FortranFixed, free formatted Fortran: FortranFree, unknown formatted Fortran:
+# Fortran. In the later case the parser tries to guess whether the code is fixed
+# or free formatted code, this is the default for Fortran type files), VHDL. For
+# instance to make doxygen treat .inc files as Fortran files (default is PHP),
+# and .f files as C (default is Fortran), use: inc=Fortran f=C.
+# Note: For files without extension you can use no_extension as a placeholder.
+# Note that for custom extensions you also need to set FILE_PATTERNS otherwise
+# the files are not read by doxygen.
+# If the MARKDOWN_SUPPORT tag is enabled then doxygen pre-processes all comments
+# according to the Markdown format, which allows for more readable
+# documentation. See http://daringfireball.net/projects/markdown/ for details.
+# The output of markdown processing is further processed by doxygen, so you can
+# mix doxygen, HTML, and XML commands with Markdown formatting. Disable only in
+# case of backward compatibilities issues.
+# The default value is: YES.
+# When the TOC_INCLUDE_HEADINGS tag is set to a non-zero value, all headings up
+# to that level are automatically included in the table of contents, even if
+# they do not have an id attribute.
+# Note: This feature currently applies only to Markdown headings.
+# Minimum value: 0, maximum value: 99, default value: 0.
+# This tag requires that the tag MARKDOWN_SUPPORT is set to YES.
+# When enabled doxygen tries to link words that correspond to documented
+# classes, or namespaces to their corresponding documentation. Such a link can
+# be prevented in individual cases by putting a % sign in front of the word or
+# globally by setting AUTOLINK_SUPPORT to NO.
+# The default value is: YES.
+# If you use STL classes (i.e. std::string, std::vector, etc.) but do not want
+# to include (a tag file for) the STL sources as input, then you should set this
+# tag to YES in order to let doxygen match functions declarations and
+# definitions whose arguments contain STL classes (e.g. func(std::string);
+# versus func(std::string) {}). This also make the inheritance and collaboration
+# diagrams that involve STL classes more complete and accurate.
+# The default value is: NO.
+# If you use Microsoft's C++/CLI language, you should set this option to YES to
+# enable parsing support.
+# The default value is: NO.
+# Set the SIP_SUPPORT tag to YES if your project consists of sip (see:
+# https://www.riverbankcomputing.com/software/sip/intro) sources only. Doxygen
+# will parse them like normal C++ but will assume all classes use public instead
+# of private inheritance when no explicit protection keyword is present.
+# The default value is: NO.
+# For Microsoft's IDL there are propget and propput attributes to indicate
+# getter and setter methods for a property. Setting this option to YES will make
+# doxygen to replace the get and set methods by a property in the documentation.
+# This will only work if the methods are indeed getting or setting a simple
+# type. If this is not the case, or you want to show the methods anyway, you
+# should set this option to NO.
+# The default value is: YES.
+# If member grouping is used in the documentation and the DISTRIBUTE_GROUP_DOC
+# tag is set to YES then doxygen will reuse the documentation of the first
+# member in the group (if any) for the other members of the group. By default
+# all members of a group must be documented explicitly.
+# The default value is: NO.
+# If one adds a struct or class to a group and this option is enabled, then also
+# any nested class or struct is added to the same group. By default this option
+# is disabled and one has to add nested compounds explicitly via \ingroup.
+# The default value is: NO.
+# Set the SUBGROUPING tag to YES to allow class member groups of the same type
+# (for instance a group of public functions) to be put as a subgroup of that
+# type (e.g. under the Public Functions section). Set it to NO to prevent
+# subgrouping. Alternatively, this can be done per class using the
+# \nosubgrouping command.
+# The default value is: YES.
+# When the INLINE_GROUPED_CLASSES tag is set to YES, classes, structs and unions
+# are shown inside the group in which they are included (e.g. using \ingroup)
+# instead of on a separate page (for HTML and Man pages) or section (for LaTeX
+# and RTF).
+# Note that this feature does not work in combination with
+# The default value is: NO.
+# When the INLINE_SIMPLE_STRUCTS tag is set to YES, structs, classes, and unions
+# with only public data fields or simple typedef fields will be shown inline in
+# the documentation of the scope in which they are defined (i.e. file,
+# namespace, or group documentation), provided this scope is documented. If set
+# to NO, structs, classes, and unions are shown on a separate page (for HTML and
+# Man pages) or section (for LaTeX and RTF).
+# The default value is: NO.
+# When TYPEDEF_HIDES_STRUCT tag is enabled, a typedef of a struct, union, or
+# enum is documented as struct, union, or enum with the name of the typedef. So
+# typedef struct TypeS {} TypeT, will appear in the documentation as a struct
+# with name TypeT. When disabled the typedef will appear as a member of a file,
+# namespace, or class. And the struct will be named TypeS. This can typically be
+# useful for C code in case the coding convention dictates that all compound
+# types are typedef'ed and only the typedef is referenced, never the tag name.
+# The default value is: NO.
+# The size of the symbol lookup cache can be set using LOOKUP_CACHE_SIZE. This
+# cache is used to resolve symbols given their name and scope. Since this can be
+# an expensive process and often the same symbol appears multiple times in the
+# code, doxygen keeps a cache of pre-resolved symbols. If the cache is too small
+# doxygen will become slower. If the cache is too large, memory is wasted. The
+# cache size is given by this formula: 2^(16+LOOKUP_CACHE_SIZE). The valid range
+# is 0..9, the default is 0, corresponding to a cache size of 2^16=65536
+# symbols. At the end of a run doxygen will report the cache usage and suggest
+# the optimal cache size from a speed point of view.
+# Minimum value: 0, maximum value: 9, default value: 0.
+# Build related configuration options
+# If the EXTRACT_ALL tag is set to YES, doxygen will assume all entities in
+# documentation are documented, even if no documentation was available. Private
+# class members and static file members will be hidden unless the
+# EXTRACT_PRIVATE respectively EXTRACT_STATIC tags are set to YES.
+# Note: This will also disable the warnings about undocumented members that are
+# normally produced when WARNINGS is set to YES.
+# The default value is: NO.
+# If the EXTRACT_PRIVATE tag is set to YES, all private members of a class will
+# be included in the documentation.
+# The default value is: NO.
+# If the EXTRACT_PACKAGE tag is set to YES, all members with package or internal
+# scope will be included in the documentation.
+# The default value is: NO.
+# If the EXTRACT_STATIC tag is set to YES, all static members of a file will be
+# included in the documentation.
+# The default value is: NO.
+# If the EXTRACT_LOCAL_CLASSES tag is set to YES, classes (and structs) defined
+# locally in source files will be included in the documentation. If set to NO,
+# only classes defined in header files are included. Does not have any effect
+# for Java sources.
+# The default value is: YES.
+# This flag is only useful for Objective-C code. If set to YES, local methods,
+# which are defined in the implementation section but not in the interface are
+# included in the documentation. If set to NO, only methods in the interface are
+# included.
+# The default value is: NO.
+# If this flag is set to YES, the members of anonymous namespaces will be
+# extracted and appear in the documentation as a namespace called
+# 'anonymous_namespace{file}', where file will be replaced with the base name of
+# the file that contains the anonymous namespace. By default anonymous namespace
+# are hidden.
+# The default value is: NO.
+# If the HIDE_UNDOC_MEMBERS tag is set to YES, doxygen will hide all
+# undocumented members inside documented classes or files. If set to NO these
+# members will be included in the various overviews, but no documentation
+# section is generated. This option has no effect if EXTRACT_ALL is enabled.
+# The default value is: NO.
+# If the HIDE_UNDOC_CLASSES tag is set to YES, doxygen will hide all
+# undocumented classes that are normally visible in the class hierarchy. If set
+# to NO, these classes will be included in the various overviews. This option
+# has no effect if EXTRACT_ALL is enabled.
+# The default value is: NO.
+# If the HIDE_FRIEND_COMPOUNDS tag is set to YES, doxygen will hide all friend
+# (class|struct|union) declarations. If set to NO, these declarations will be
+# included in the documentation.
+# The default value is: NO.
+# If the HIDE_IN_BODY_DOCS tag is set to YES, doxygen will hide any
+# documentation blocks found inside the body of a function. If set to NO, these
+# blocks will be appended to the function's detailed documentation block.
+# The default value is: NO.
+# The INTERNAL_DOCS tag determines if documentation that is typed after a
+# \internal command is included. If the tag is set to NO then the documentation
+# will be excluded. Set it to YES to include the internal documentation.
+# The default value is: NO.
+# If the CASE_SENSE_NAMES tag is set to NO then doxygen will only generate file
+# names in lower-case letters. If set to YES, upper-case letters are also
+# allowed. This is useful if you have classes or files whose names only differ
+# in case and if your file system supports case sensitive file names. Windows
+# and Mac users are advised to set this option to NO.
+# The default value is: system dependent.
+# If the HIDE_SCOPE_NAMES tag is set to NO then doxygen will show members with
+# their full class and namespace scopes in the documentation. If set to YES, the
+# scope will be hidden.
+# The default value is: NO.
+# If the HIDE_COMPOUND_REFERENCE tag is set to NO (default) then doxygen will
+# append additional text to a page's title, such as Class Reference. If set to
+# YES the compound reference will be hidden.
+# The default value is: NO.
+# If the SHOW_INCLUDE_FILES tag is set to YES then doxygen will put a list of
+# the files that are included by a file in the documentation of that file.
+# The default value is: YES.
+# If the SHOW_GROUPED_MEMB_INC tag is set to YES then Doxygen will add for each
+# grouped member an include statement to the documentation, telling the reader
+# which file to include in order to use the member.
+# The default value is: NO.
+# If the FORCE_LOCAL_INCLUDES tag is set to YES then doxygen will list include
+# files with double quotes in the documentation rather than with sharp brackets.
+# The default value is: NO.
+# If the INLINE_INFO tag is set to YES then a tag [inline] is inserted in the
+# documentation for inline members.
+# The default value is: YES.
+# If the SORT_MEMBER_DOCS tag is set to YES then doxygen will sort the
+# (detailed) documentation of file and class members alphabetically by member
+# name. If set to NO, the members will appear in declaration order.
+# The default value is: YES.
+# If the SORT_BRIEF_DOCS tag is set to YES then doxygen will sort the brief
+# descriptions of file, namespace and class members alphabetically by member
+# name. If set to NO, the members will appear in declaration order. Note that
+# this will also influence the order of the classes in the class list.
+# The default value is: NO.
+# If the SORT_MEMBERS_CTORS_1ST tag is set to YES then doxygen will sort the
+# (brief and detailed) documentation of class members so that constructors and
+# destructors are listed first. If set to NO the constructors will appear in the
+# respective orders defined by SORT_BRIEF_DOCS and SORT_MEMBER_DOCS.
+# Note: If SORT_BRIEF_DOCS is set to NO this option is ignored for sorting brief
+# member documentation.
+# Note: If SORT_MEMBER_DOCS is set to NO this option is ignored for sorting
+# detailed member documentation.
+# The default value is: NO.
+# If the SORT_GROUP_NAMES tag is set to YES then doxygen will sort the hierarchy
+# of group names into alphabetical order. If set to NO the group names will
+# appear in their defined order.
+# The default value is: NO.
+# If the SORT_BY_SCOPE_NAME tag is set to YES, the class list will be sorted by
+# fully-qualified names, including namespaces. If set to NO, the class list will
+# be sorted only by class name, not including the namespace part.
+# Note: This option is not very useful if HIDE_SCOPE_NAMES is set to YES.
+# Note: This option applies only to the class list, not to the alphabetical
+# list.
+# The default value is: NO.
+# If the STRICT_PROTO_MATCHING option is enabled and doxygen fails to do proper
+# type resolution of all parameters of a function it will reject a match between
+# the prototype and the implementation of a member function even if there is
+# only one candidate or it is obvious which candidate to choose by doing a
+# simple string match. By disabling STRICT_PROTO_MATCHING doxygen will still
+# accept a match between prototype and implementation in such cases.
+# The default value is: NO.
+# The GENERATE_TODOLIST tag can be used to enable (YES) or disable (NO) the todo
+# list. This list is created by putting \todo commands in the documentation.
+# The default value is: YES.
+# The GENERATE_TESTLIST tag can be used to enable (YES) or disable (NO) the test
+# list. This list is created by putting \test commands in the documentation.
+# The default value is: YES.
+# The GENERATE_BUGLIST tag can be used to enable (YES) or disable (NO) the bug
+# list. This list is created by putting \bug commands in the documentation.
+# The default value is: YES.
+# The GENERATE_DEPRECATEDLIST tag can be used to enable (YES) or disable (NO)
+# the deprecated list. This list is created by putting \deprecated commands in
+# the documentation.
+# The default value is: YES.
+# The ENABLED_SECTIONS tag can be used to enable conditional documentation
+# sections, marked by \if <section_label> ... \endif and \cond <section_label>
+# ... \endcond blocks.
+# The MAX_INITIALIZER_LINES tag determines the maximum number of lines that the
+# initial value of a variable or macro / define can have for it to appear in the
+# documentation. If the initializer consists of more lines than specified here
+# it will be hidden. Use a value of 0 to hide initializers completely. The
+# appearance of the value of individual variables and macros / defines can be
+# controlled using \showinitializer or \hideinitializer command in the
+# documentation regardless of this setting.
+# Minimum value: 0, maximum value: 10000, default value: 30.
+# Set the SHOW_USED_FILES tag to NO to disable the list of files generated at
+# the bottom of the documentation of classes and structs. If set to YES, the
+# list will mention the files that were used to generate the documentation.
+# The default value is: YES.
+# Set the SHOW_FILES tag to NO to disable the generation of the Files page. This
+# will remove the Files entry from the Quick Index and from the Folder Tree View
+# (if specified).
+# The default value is: YES.
+# Set the SHOW_NAMESPACES tag to NO to disable the generation of the Namespaces
+# page. This will remove the Namespaces entry from the Quick Index and from the
+# Folder Tree View (if specified).
+# The default value is: YES.
+# The FILE_VERSION_FILTER tag can be used to specify a program or script that
+# doxygen should invoke to get the current version for each file (typically from
+# the version control system). Doxygen will invoke the program by executing (via
+# popen()) the command command input-file, where command is the value of the
+# FILE_VERSION_FILTER tag, and input-file is the name of an input file provided
+# by doxygen. Whatever the program writes to standard output is used as the file
+# version. For an example see the documentation.
+# The LAYOUT_FILE tag can be used to specify a layout file which will be parsed
+# by doxygen. The layout file controls the global structure of the generated
+# output files in an output format independent way. To create the layout file
+# that represents doxygen's defaults, run doxygen with the -l option. You can
+# optionally specify a file name after the option, if omitted DoxygenLayout.xml
+# will be used as the name of the layout file.
+# Note that if you run doxygen from a directory containing a file called
+# DoxygenLayout.xml, doxygen will parse it automatically even if the LAYOUT_FILE
+# tag is left empty.
+# The CITE_BIB_FILES tag can be used to specify one or more bib files containing
+# the reference definitions. This must be a list of .bib files. The .bib
+# extension is automatically appended if omitted. This requires the bibtex tool
+# to be installed. See also https://en.wikipedia.org/wiki/BibTeX for more info.
+# For LaTeX the style of the bibliography can be controlled using
+# LATEX_BIB_STYLE. To use this feature you need bibtex and perl available in the
+# search path. See also \cite for info how to create references.
+# Configuration options related to warning and progress messages
+# The QUIET tag can be used to turn on/off the messages that are generated to
+# standard output by doxygen. If QUIET is set to YES this implies that the
+# messages are off.
+# The default value is: NO.
+# The WARNINGS tag can be used to turn on/off the warning messages that are
+# generated to standard error (stderr) by doxygen. If WARNINGS is set to YES
+# this implies that the warnings are on.
+# Tip: Turn warnings on while writing the documentation.
+# The default value is: YES.
+# If the WARN_IF_UNDOCUMENTED tag is set to YES then doxygen will generate
+# warnings for undocumented members. If EXTRACT_ALL is set to YES then this flag
+# will automatically be disabled.
+# The default value is: YES.
+# If the WARN_IF_DOC_ERROR tag is set to YES, doxygen will generate warnings for
+# potential errors in the documentation, such as not documenting some parameters
+# in a documented function, or documenting parameters that don't exist or using
+# markup commands wrongly.
+# The default value is: YES.
+# This WARN_NO_PARAMDOC option can be enabled to get warnings for functions that
+# are documented, but have no documentation for their parameters or return
+# value. If set to NO, doxygen will only warn about wrong or incomplete
+# parameter documentation, but not about the absence of documentation.
+# The default value is: NO.
+# If the WARN_AS_ERROR tag is set to YES then doxygen will immediately stop when
+# a warning is encountered.
+# The default value is: NO.
+# The WARN_FORMAT tag determines the format of the warning messages that doxygen
+# can produce. The string should contain the $file, $line, and $text tags, which
+# will be replaced by the file and line number from which the warning originated
+# and the warning text. Optionally the format may contain $version, which will
+# be replaced by the version of the file (if it could be obtained via
+# The default value is: $file:$line: $text.
+WARN_FORMAT = "$file:$line: $text"
+# The WARN_LOGFILE tag can be used to specify a file to which warning and error
+# messages should be written. If left blank the output is written to standard
+# error (stderr).
+# Configuration options related to the input files
+# The INPUT tag is used to specify the files and/or directories that contain
+# documented source files. You may enter file names like myfile.cpp or
+# directories like /usr/src/myproject. Separate the files or directories with
+# Note: If this tag is empty the current directory is searched.
+INPUT = ./d2tk
+# This tag can be used to specify the character encoding of the source files
+# that doxygen parses. Internally doxygen uses the UTF-8 encoding. Doxygen uses
+# libiconv (or the iconv built into libc) for the transcoding. See the libiconv
+# documentation (see: https://www.gnu.org/software/libiconv/) for the list of
+# possible encodings.
+# The default value is: UTF-8.
+# If the value of the INPUT tag contains directories, you can use the
+# FILE_PATTERNS tag to specify one or more wildcard patterns (like *.cpp and
+# *.h) to filter out the source-files in the directories.
+# Note that for custom extensions or not directly supported extensions you also
+# need to set EXTENSION_MAPPING for the extension otherwise the files are not
+# read by doxygen.
+# If left blank the following patterns are tested:*.c, *.cc, *.cxx, *.cpp,
+# *.c++, *.java, *.ii, *.ixx, *.ipp, *.i++, *.inl, *.idl, *.ddl, *.odl, *.h,
+# *.hh, *.hxx, *.hpp, *.h++, *.cs, *.d, *.php, *.php4, *.php5, *.phtml, *.inc,
+# *.m, *.markdown, *.md, *.mm, *.dox, *.py, *.pyw, *.f90, *.f95, *.f03, *.f08,
+# *.f, *.for, *.tcl, *.vhd, *.vhdl, *.ucf and *.qsf.
+ *.cc \
+ *.cxx \
+ *.cpp \
+ *.c++ \
+ *.java \
+ *.ii \
+ *.ixx \
+ *.ipp \
+ *.i++ \
+ *.inl \
+ *.idl \
+ *.ddl \
+ *.odl \
+ *.h \
+ *.hh \
+ *.hxx \
+ *.hpp \
+ *.h++ \
+ *.cs \
+ *.d \
+ *.php \
+ *.php4 \
+ *.php5 \
+ *.phtml \
+ *.inc \
+ *.m \
+ *.markdown \
+ *.md \
+ *.mm \
+ *.dox \
+ *.py \
+ *.pyw \
+ *.f90 \
+ *.f95 \
+ *.f03 \
+ *.f08 \
+ *.f \
+ *.for \
+ *.tcl \
+ *.vhd \
+ *.vhdl \
+ *.ucf \
+ *.qsf
+# The RECURSIVE tag can be used to specify whether or not subdirectories should
+# be searched for input files as well.
+# The default value is: NO.
+# The EXCLUDE tag can be used to specify files and/or directories that should be
+# excluded from the INPUT source files. This way you can easily exclude a
+# subdirectory from a directory tree whose root is specified with the INPUT tag.
+# Note that relative paths are relative to the directory from which doxygen is
+# run.
+# The EXCLUDE_SYMLINKS tag can be used to select whether or not files or
+# directories that are symbolic links (a Unix file system feature) are excluded
+# from the input.
+# The default value is: NO.
+# If the value of the INPUT tag contains directories, you can use the
+# EXCLUDE_PATTERNS tag to specify one or more wildcard patterns to exclude
+# certain files from those directories.
+# Note that the wildcards are matched against the file with absolute path, so to
+# exclude all test directories for example use the pattern */test/*
+# The EXCLUDE_SYMBOLS tag can be used to specify one or more symbol names
+# (namespaces, classes, functions, etc.) that should be excluded from the
+# output. The symbol name can be a fully qualified name, a word, or if the
+# wildcard * is used, a substring. Examples: ANamespace, AClass,
+# AClass::ANamespace, ANamespace::*Test
+# Note that the wildcards are matched against the file with absolute path, so to
+# exclude all test directories use the pattern */test/*
+# The EXAMPLE_PATH tag can be used to specify one or more files or directories
+# that contain example code fragments that are included (see the \include
+# command).
+# If the value of the EXAMPLE_PATH tag contains directories, you can use the
+# EXAMPLE_PATTERNS tag to specify one or more wildcard pattern (like *.cpp and
+# *.h) to filter out the source-files in the directories. If left blank all
+# files are included.
+# If the EXAMPLE_RECURSIVE tag is set to YES then subdirectories will be
+# searched for input files to be used with the \include or \dontinclude commands
+# irrespective of the value of the RECURSIVE tag.
+# The default value is: NO.
+# The IMAGE_PATH tag can be used to specify one or more files or directories
+# that contain images that are to be included in the documentation (see the
+# \image command).
+# The INPUT_FILTER tag can be used to specify a program that doxygen should
+# invoke to filter for each input file. Doxygen will invoke the filter program
+# by executing (via popen()) the command:
+# <filter> <input-file>
+# where <filter> is the value of the INPUT_FILTER tag, and <input-file> is the
+# name of an input file. Doxygen will then use the output that the filter
+# program writes to standard output. If FILTER_PATTERNS is specified, this tag
+# will be ignored.
+# Note that the filter must not add or remove lines; it is applied before the
+# code is scanned, but not when the output code is generated. If lines are added
+# or removed, the anchors will not be placed correctly.
+# Note that for custom extensions or not directly supported extensions you also
+# need to set EXTENSION_MAPPING for the extension otherwise the files are not
+# properly processed by doxygen.
+# The FILTER_PATTERNS tag can be used to specify filters on a per file pattern
+# basis. Doxygen will compare the file name with each pattern and apply the
+# filter if there is a match. The filters are a list of the form: pattern=filter
+# (like *.cpp=my_cpp_filter). See INPUT_FILTER for further information on how
+# filters are used. If the FILTER_PATTERNS tag is empty or if none of the
+# patterns match the file name, INPUT_FILTER is applied.
+# Note that for custom extensions or not directly supported extensions you also
+# need to set EXTENSION_MAPPING for the extension otherwise the files are not
+# properly processed by doxygen.
+# If the FILTER_SOURCE_FILES tag is set to YES, the input filter (if set using
+# INPUT_FILTER) will also be used to filter the input files that are used for
+# producing the source files to browse (i.e. when SOURCE_BROWSER is set to YES).
+# The default value is: NO.
+# The FILTER_SOURCE_PATTERNS tag can be used to specify source filters per file
+# pattern. A pattern will override the setting for FILTER_PATTERN (if any) and
+# it is also possible to disable source filtering for a specific pattern using
+# *.ext= (so without naming a filter).
+# This tag requires that the tag FILTER_SOURCE_FILES is set to YES.
+# If the USE_MDFILE_AS_MAINPAGE tag refers to the name of a markdown file that
+# is part of the input, its contents will be placed on the main page
+# (index.html). This can be useful if you have a project on for instance GitHub
+# and want to reuse the introduction page also for the doxygen output.
+# Configuration options related to source browsing
+# If the SOURCE_BROWSER tag is set to YES then a list of source files will be
+# generated. Documented entities will be cross-referenced with these sources.
+# Note: To get rid of all source code in the generated output, make sure that
+# also VERBATIM_HEADERS is set to NO.
+# The default value is: NO.
+# Setting the INLINE_SOURCES tag to YES will include the body of functions,
+# classes and enums directly into the documentation.
+# The default value is: NO.
+# Setting the STRIP_CODE_COMMENTS tag to YES will instruct doxygen to hide any
+# special comment blocks from generated source code fragments. Normal C, C++ and
+# Fortran comments will always remain visible.
+# The default value is: YES.
+# If the REFERENCED_BY_RELATION tag is set to YES then for each documented
+# function all documented functions referencing it will be listed.
+# The default value is: NO.
+# If the REFERENCES_RELATION tag is set to YES then for each documented function
+# all documented entities called/used by that function will be listed.
+# The default value is: NO.
+# If the REFERENCES_LINK_SOURCE tag is set to YES and SOURCE_BROWSER tag is set
+# to YES then the hyperlinks from functions in REFERENCES_RELATION and
+# REFERENCED_BY_RELATION lists will link to the source code. Otherwise they will
+# link to the documentation.
+# The default value is: YES.
+# If SOURCE_TOOLTIPS is enabled (the default) then hovering a hyperlink in the
+# source code will show a tooltip with additional information such as prototype,
+# brief description and links to the definition and documentation. Since this
+# will make the HTML file larger and loading of large files a bit slower, you
+# can opt to disable this feature.
+# The default value is: YES.
+# This tag requires that the tag SOURCE_BROWSER is set to YES.
+# If the USE_HTAGS tag is set to YES then the references to source code will
+# point to the HTML generated by the htags(1) tool instead of doxygen built-in
+# source browser. The htags tool is part of GNU's global source tagging system
+# (see https://www.gnu.org/software/global/global.html). You will need version
+# 4.8.6 or higher.
+# To use it do the following:
+# - Install the latest version of global
+# - Enable SOURCE_BROWSER and USE_HTAGS in the config file
+# - Make sure the INPUT points to the root of the source tree
+# - Run doxygen as normal
+# Doxygen will invoke htags (and that will in turn invoke gtags), so these
+# tools must be available from the command line (i.e. in the search path).
+# The result: instead of the source browser generated by doxygen, the links to
+# source code will now point to the output of htags.
+# The default value is: NO.
+# This tag requires that the tag SOURCE_BROWSER is set to YES.
+# If the VERBATIM_HEADERS tag is set the YES then doxygen will generate a
+# verbatim copy of the header file for each class for which an include is
+# specified. Set to NO to disable this.
+# See also: Section \class.
+# The default value is: YES.
+# Configuration options related to the alphabetical class index
+# If the ALPHABETICAL_INDEX tag is set to YES, an alphabetical index of all
+# compounds will be generated. Enable this if the project contains a lot of
+# classes, structs, unions or interfaces.
+# The default value is: YES.
+# The COLS_IN_ALPHA_INDEX tag can be used to specify the number of columns in
+# which the alphabetical index list will be split.
+# Minimum value: 1, maximum value: 20, default value: 5.
+# This tag requires that the tag ALPHABETICAL_INDEX is set to YES.
+# In case all classes in a project start with a common prefix, all classes will
+# be put under the same header in the alphabetical index. The IGNORE_PREFIX tag
+# can be used to specify a prefix (or a list of prefixes) that should be ignored
+# while generating the index headers.
+# This tag requires that the tag ALPHABETICAL_INDEX is set to YES.
+# Configuration options related to the HTML output
+# If the GENERATE_HTML tag is set to YES, doxygen will generate HTML output
+# The default value is: YES.
+# The HTML_OUTPUT tag is used to specify where the HTML docs will be put. If a
+# relative path is entered the value of OUTPUT_DIRECTORY will be put in front of
+# it.
+# The default directory is: html.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# The HTML_FILE_EXTENSION tag can be used to specify the file extension for each
+# generated HTML page (for example: .htm, .php, .asp).
+# The default value is: .html.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# The HTML_HEADER tag can be used to specify a user-defined HTML header file for
+# each generated HTML page. If the tag is left blank doxygen will generate a
+# standard header.
+# To get valid HTML the header file that includes any scripts and style sheets
+# that doxygen needs, which is dependent on the configuration options used (e.g.
+# the setting GENERATE_TREEVIEW). It is highly recommended to start with a
+# default header using
+# doxygen -w html new_header.html new_footer.html new_stylesheet.css
+# YourConfigFile
+# and then modify the file new_header.html. See also section "Doxygen usage"
+# for information on how to generate the default header that doxygen normally
+# uses.
+# Note: The header is subject to change so you typically have to regenerate the
+# default header when upgrading to a newer version of doxygen. For a description
+# of the possible markers and block names see the documentation.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# The HTML_FOOTER tag can be used to specify a user-defined HTML footer for each
+# generated HTML page. If the tag is left blank doxygen will generate a standard
+# footer. See HTML_HEADER for more information on how to generate a default
+# footer and what special commands can be used inside the footer. See also
+# section "Doxygen usage" for information on how to generate the default footer
+# that doxygen normally uses.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# The HTML_STYLESHEET tag can be used to specify a user-defined cascading style
+# sheet that is used by each HTML page. It can be used to fine-tune the look of
+# the HTML output. If left blank doxygen will generate a default style sheet.
+# See also section "Doxygen usage" for information on how to generate the style
+# sheet that doxygen normally uses.
+# Note: It is recommended to use HTML_EXTRA_STYLESHEET instead of this tag, as
+# it is more robust and this tag (HTML_STYLESHEET) will in the future become
+# obsolete.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# The HTML_EXTRA_STYLESHEET tag can be used to specify additional user-defined
+# cascading style sheets that are included after the standard style sheets
+# created by doxygen. Using this option one can overrule certain style aspects.
+# This is preferred over using HTML_STYLESHEET since it does not replace the
+# standard style sheet and is therefore more robust against future updates.
+# Doxygen will copy the style sheet files to the output directory.
+# Note: The order of the extra style sheet files is of importance (e.g. the last
+# style sheet in the list overrules the setting of the previous ones in the
+# list). For an example see the documentation.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# The HTML_EXTRA_FILES tag can be used to specify one or more extra images or
+# other source files which should be copied to the HTML output directory. Note
+# that these files will be copied to the base HTML output directory. Use the
+# $relpath^ marker in the HTML_HEADER and/or HTML_FOOTER files to load these
+# files. In the HTML_STYLESHEET file, use the file name only. Also note that the
+# files will be copied as-is; there are no commands or markers available.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# The HTML_COLORSTYLE_HUE tag controls the color of the HTML output. Doxygen
+# will adjust the colors in the style sheet and background images according to
+# this color. Hue is specified as an angle on a colorwheel, see
+# https://en.wikipedia.org/wiki/Hue for more information. For instance the value
+# 0 represents red, 60 is yellow, 120 is green, 180 is cyan, 240 is blue, 300
+# purple, and 360 is red again.
+# Minimum value: 0, maximum value: 359, default value: 220.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# The HTML_COLORSTYLE_SAT tag controls the purity (or saturation) of the colors
+# in the HTML output. For a value of 0 the output will use grayscales only. A
+# value of 255 will produce the most vivid colors.
+# Minimum value: 0, maximum value: 255, default value: 100.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# The HTML_COLORSTYLE_GAMMA tag controls the gamma correction applied to the
+# luminance component of the colors in the HTML output. Values below 100
+# gradually make the output lighter, whereas values above 100 make the output
+# darker. The value divided by 100 is the actual gamma applied, so 80 represents
+# a gamma of 0.8, The value 220 represents a gamma of 2.2, and 100 does not
+# change the gamma.
+# Minimum value: 40, maximum value: 240, default value: 80.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# If the HTML_TIMESTAMP tag is set to YES then the footer of each generated HTML
+# page will contain the date and time when the page was generated. Setting this
+# to YES can help to show when doxygen was last run and thus if the
+# documentation is up to date.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# If the HTML_DYNAMIC_MENUS tag is set to YES then the generated HTML
+# documentation will contain a main index with vertical navigation menus that
+# are dynamically created via Javascript. If disabled, the navigation index will
+# consists of multiple levels of tabs that are statically embedded in every HTML
+# page. Disable this option to support browsers that do not have Javascript,
+# like the Qt help browser.
+# The default value is: YES.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# If the HTML_DYNAMIC_SECTIONS tag is set to YES then the generated HTML
+# documentation will contain sections that can be hidden and shown after the
+# page has loaded.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# With HTML_INDEX_NUM_ENTRIES one can control the preferred number of entries
+# shown in the various tree structured indices initially; the user can expand
+# and collapse entries dynamically later on. Doxygen will expand the tree to
+# such a level that at most the specified number of entries are visible (unless
+# a fully collapsed tree already exceeds this amount). So setting the number of
+# entries 1 will produce a full collapsed tree by default. 0 is a special value
+# representing an infinite number of entries and will result in a full expanded
+# tree by default.
+# Minimum value: 0, maximum value: 9999, default value: 100.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# If the GENERATE_DOCSET tag is set to YES, additional index files will be
+# generated that can be used as input for Apple's Xcode 3 integrated development
+# environment (see: https://developer.apple.com/tools/xcode/), introduced with
+# OSX 10.5 (Leopard). To create a documentation set, doxygen will generate a
+# Makefile in the HTML output directory. Running make will produce the docset in
+# that directory and running make install will install the docset in
+# ~/Library/Developer/Shared/Documentation/DocSets so that Xcode will find it at
+# startup. See https://developer.apple.com/tools/creatingdocsetswithdoxygen.html
+# for more information.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# This tag determines the name of the docset feed. A documentation feed provides
+# an umbrella under which multiple documentation sets from a single provider
+# (such as a company or product suite) can be grouped.
+# The default value is: Doxygen generated docs.
+# This tag requires that the tag GENERATE_DOCSET is set to YES.
+DOCSET_FEEDNAME = "Doxygen generated docs"
+# This tag specifies a string that should uniquely identify the documentation
+# set bundle. This should be a reverse domain-name style string, e.g.
+# com.mycompany.MyDocSet. Doxygen will append .docset to the name.
+# The default value is: org.doxygen.Project.
+# This tag requires that the tag GENERATE_DOCSET is set to YES.
+DOCSET_BUNDLE_ID = org.doxygen.Project
+# The DOCSET_PUBLISHER_ID tag specifies a string that should uniquely identify
+# the documentation publisher. This should be a reverse domain-name style
+# string, e.g. com.mycompany.MyDocSet.documentation.
+# The default value is: org.doxygen.Publisher.
+# This tag requires that the tag GENERATE_DOCSET is set to YES.
+DOCSET_PUBLISHER_ID = org.doxygen.Publisher
+# The DOCSET_PUBLISHER_NAME tag identifies the documentation publisher.
+# The default value is: Publisher.
+# This tag requires that the tag GENERATE_DOCSET is set to YES.
+# If the GENERATE_HTMLHELP tag is set to YES then doxygen generates three
+# additional HTML index files: index.hhp, index.hhc, and index.hhk. The
+# index.hhp is a project file that can be read by Microsoft's HTML Help Workshop
+# (see: http://www.microsoft.com/en-us/download/details.aspx?id=21138) on
+# Windows.
+# The HTML Help Workshop contains a compiler that can convert all HTML output
+# generated by doxygen into a single compiled HTML file (.chm). Compiled HTML
+# files are now used as the Windows 98 help format, and will replace the old
+# Windows help format (.hlp) on all Windows platforms in the future. Compressed
+# HTML files also contain an index, a table of contents, and you can search for
+# words in the documentation. The HTML workshop also contains a viewer for
+# compressed HTML files.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# The CHM_FILE tag can be used to specify the file name of the resulting .chm
+# file. You can add a path in front of the file if the result should not be
+# written to the html output directory.
+# This tag requires that the tag GENERATE_HTMLHELP is set to YES.
+# The HHC_LOCATION tag can be used to specify the location (absolute path
+# including file name) of the HTML help compiler (hhc.exe). If non-empty,
+# doxygen will try to run the HTML help compiler on the generated index.hhp.
+# The file has to be specified with full path.
+# This tag requires that the tag GENERATE_HTMLHELP is set to YES.
+# The GENERATE_CHI flag controls if a separate .chi index file is generated
+# (YES) or that it should be included in the master .chm file (NO).
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTMLHELP is set to YES.
+# The CHM_INDEX_ENCODING is used to encode HtmlHelp index (hhk), content (hhc)
+# and project file content.
+# This tag requires that the tag GENERATE_HTMLHELP is set to YES.
+# The BINARY_TOC flag controls whether a binary table of contents is generated
+# (YES) or a normal table of contents (NO) in the .chm file. Furthermore it
+# enables the Previous and Next buttons.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTMLHELP is set to YES.
+# The TOC_EXPAND flag can be set to YES to add extra items for group members to
+# the table of contents of the HTML help documentation and to the tree view.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTMLHELP is set to YES.
+# If the GENERATE_QHP tag is set to YES and both QHP_NAMESPACE and
+# QHP_VIRTUAL_FOLDER are set, an additional index file will be generated that
+# can be used as input for Qt's qhelpgenerator to generate a Qt Compressed Help
+# (.qch) of the generated HTML documentation.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# If the QHG_LOCATION tag is specified, the QCH_FILE tag can be used to specify
+# the file name of the resulting .qch file. The path specified is relative to
+# the HTML output folder.
+# This tag requires that the tag GENERATE_QHP is set to YES.
+# The QHP_NAMESPACE tag specifies the namespace to use when generating Qt Help
+# Project output. For more information please see Qt Help Project / Namespace
+# (see: http://doc.qt.io/qt-4.8/qthelpproject.html#namespace).
+# The default value is: org.doxygen.Project.
+# This tag requires that the tag GENERATE_QHP is set to YES.
+QHP_NAMESPACE = org.doxygen.Project
+# The QHP_VIRTUAL_FOLDER tag specifies the namespace to use when generating Qt
+# Help Project output. For more information please see Qt Help Project / Virtual
+# Folders (see: http://doc.qt.io/qt-4.8/qthelpproject.html#virtual-folders).
+# The default value is: doc.
+# This tag requires that the tag GENERATE_QHP is set to YES.
+# If the QHP_CUST_FILTER_NAME tag is set, it specifies the name of a custom
+# filter to add. For more information please see Qt Help Project / Custom
+# Filters (see: http://doc.qt.io/qt-4.8/qthelpproject.html#custom-filters).
+# This tag requires that the tag GENERATE_QHP is set to YES.
+# The QHP_CUST_FILTER_ATTRS tag specifies the list of the attributes of the
+# custom filter to add. For more information please see Qt Help Project / Custom
+# Filters (see: http://doc.qt.io/qt-4.8/qthelpproject.html#custom-filters).
+# This tag requires that the tag GENERATE_QHP is set to YES.
+# The QHP_SECT_FILTER_ATTRS tag specifies the list of the attributes this
+# project's filter section matches. Qt Help Project / Filter Attributes (see:
+# http://doc.qt.io/qt-4.8/qthelpproject.html#filter-attributes).
+# This tag requires that the tag GENERATE_QHP is set to YES.
+# The QHG_LOCATION tag can be used to specify the location of Qt's
+# qhelpgenerator. If non-empty doxygen will try to run qhelpgenerator on the
+# generated .qhp file.
+# This tag requires that the tag GENERATE_QHP is set to YES.
+# If the GENERATE_ECLIPSEHELP tag is set to YES, additional index files will be
+# generated, together with the HTML files, they form an Eclipse help plugin. To
+# install this plugin and make it available under the help contents menu in
+# Eclipse, the contents of the directory containing the HTML and XML files needs
+# to be copied into the plugins directory of eclipse. The name of the directory
+# within the plugins directory should be the same as the ECLIPSE_DOC_ID value.
+# After copying Eclipse needs to be restarted before the help appears.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# A unique identifier for the Eclipse help plugin. When installing the plugin
+# the directory name containing the HTML and XML files should also have this
+# name. Each documentation set should have its own identifier.
+# The default value is: org.doxygen.Project.
+# This tag requires that the tag GENERATE_ECLIPSEHELP is set to YES.
+ECLIPSE_DOC_ID = org.doxygen.Project
+# If you want full control over the layout of the generated HTML pages it might
+# be necessary to disable the index and replace it with your own. The
+# DISABLE_INDEX tag can be used to turn on/off the condensed index (tabs) at top
+# of each HTML page. A value of NO enables the index and the value YES disables
+# it. Since the tabs in the index contain the same information as the navigation
+# tree, you can set this option to YES if you also set GENERATE_TREEVIEW to YES.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# The GENERATE_TREEVIEW tag is used to specify whether a tree-like index
+# structure should be generated to display hierarchical information. If the tag
+# value is set to YES, a side panel will be generated containing a tree-like
+# index structure (just like the one that is generated for HTML Help). For this
+# to work a browser that supports JavaScript, DHTML, CSS and frames is required
+# (i.e. any modern browser). Windows users are probably better off using the
+# HTML help feature. Via custom style sheets (see HTML_EXTRA_STYLESHEET) one can
+# further fine-tune the look of the index. As an example, the default style
+# sheet generated by doxygen has an example that shows how to put an image at
+# the root of the tree instead of the PROJECT_NAME. Since the tree basically has
+# the same information as the tab index, you could consider setting
+# DISABLE_INDEX to YES when enabling this option.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# The ENUM_VALUES_PER_LINE tag can be used to set the number of enum values that
+# doxygen will group on one line in the generated HTML documentation.
+# Note that a value of 0 will completely suppress the enum values from appearing
+# in the overview section.
+# Minimum value: 0, maximum value: 20, default value: 4.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# If the treeview is enabled (see GENERATE_TREEVIEW) then this tag can be used
+# to set the initial width (in pixels) of the frame in which the tree is shown.
+# Minimum value: 0, maximum value: 1500, default value: 250.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# If the EXT_LINKS_IN_WINDOW option is set to YES, doxygen will open links to
+# external symbols imported via tag files in a separate window.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# Use this tag to change the font size of LaTeX formulas included as images in
+# the HTML documentation. When you change the font size after a successful
+# doxygen run you need to manually remove any form_*.png images from the HTML
+# output directory to force them to be regenerated.
+# Minimum value: 8, maximum value: 50, default value: 10.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# Use the FORMULA_TRANSPARENT tag to determine whether or not the images
+# generated for formulas are transparent PNGs. Transparent PNGs are not
+# supported properly for IE 6.0, but are supported on all modern browsers.
+# Note that when changing this option you need to delete any form_*.png files in
+# the HTML output directory before the changes have effect.
+# The default value is: YES.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# Enable the USE_MATHJAX option to render LaTeX formulas using MathJax (see
+# https://www.mathjax.org) which uses client side Javascript for the rendering
+# instead of using pre-rendered bitmaps. Use this if you do not have LaTeX
+# installed or if you want to formulas look prettier in the HTML output. When
+# enabled you may also need to install MathJax separately and configure the path
+# to it using the MATHJAX_RELPATH option.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# When MathJax is enabled you can set the default output format to be used for
+# the MathJax output. See the MathJax site (see:
+# http://docs.mathjax.org/en/latest/output.html) for more details.
+# Possible values are: HTML-CSS (which is slower, but has the best
+# compatibility), NativeMML (i.e. MathML) and SVG.
+# The default value is: HTML-CSS.
+# This tag requires that the tag USE_MATHJAX is set to YES.
+# When MathJax is enabled you need to specify the location relative to the HTML
+# output directory using the MATHJAX_RELPATH option. The destination directory
+# should contain the MathJax.js script. For instance, if the mathjax directory
+# is located at the same level as the HTML output directory, then
+# MATHJAX_RELPATH should be ../mathjax. The default value points to the MathJax
+# Content Delivery Network so you can quickly see the result without installing
+# MathJax. However, it is strongly recommended to install a local copy of
+# MathJax from https://www.mathjax.org before deployment.
+# The default value is: https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.2/.
+# This tag requires that the tag USE_MATHJAX is set to YES.
+MATHJAX_RELPATH = https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.2/
+# The MATHJAX_EXTENSIONS tag can be used to specify one or more MathJax
+# extension names that should be enabled during MathJax rendering. For example
+# This tag requires that the tag USE_MATHJAX is set to YES.
+# The MATHJAX_CODEFILE tag can be used to specify a file with javascript pieces
+# of code that will be used on startup of the MathJax code. See the MathJax site
+# (see: http://docs.mathjax.org/en/latest/output.html) for more details. For an
+# example see the documentation.
+# This tag requires that the tag USE_MATHJAX is set to YES.
+# When the SEARCHENGINE tag is enabled doxygen will generate a search box for
+# the HTML output. The underlying search engine uses javascript and DHTML and
+# should work on any modern browser. Note that when using HTML help
+# there is already a search function so this one should typically be disabled.
+# For large projects the javascript based search engine can be slow, then
+# enabling SERVER_BASED_SEARCH may provide a better solution. It is possible to
+# search using the keyboard; to jump to the search box use <access key> + S
+# (what the <access key> is depends on the OS and browser, but it is typically
+# <CTRL>, <ALT>/<option>, or both). Inside the search box use the <cursor down
+# key> to jump into the search results window, the results can be navigated
+# using the <cursor keys>. Press <Enter> to select an item or <escape> to cancel
+# the search. The filter options can be selected when the cursor is inside the
+# search box by pressing <Shift>+<cursor down>. Also here use the <cursor keys>
+# to select a filter and <Enter> or <escape> to activate or cancel the filter
+# option.
+# The default value is: YES.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+# When the SERVER_BASED_SEARCH tag is enabled the search engine will be
+# implemented using a web server instead of a web client using Javascript. There
+# are two flavors of web server based searching depending on the EXTERNAL_SEARCH
+# setting. When disabled, doxygen will generate a PHP script for searching and
+# an index file used by the script. When EXTERNAL_SEARCH is enabled the indexing
+# and searching needs to be provided by external tools. See the section
+# "External Indexing and Searching" for details.
+# The default value is: NO.
+# This tag requires that the tag SEARCHENGINE is set to YES.
+# When EXTERNAL_SEARCH tag is enabled doxygen will no longer generate the PHP
+# script for searching. Instead the search results are written to an XML file
+# which needs to be processed by an external indexer. Doxygen will invoke an
+# external search engine pointed to by the SEARCHENGINE_URL option to obtain the
+# search results.
+# Doxygen ships with an example indexer (doxyindexer) and search engine
+# (doxysearch.cgi) which are based on the open source search engine library
+# Xapian (see: https://xapian.org/).
+# See the section "External Indexing and Searching" for details.
+# The default value is: NO.
+# This tag requires that the tag SEARCHENGINE is set to YES.
+# The SEARCHENGINE_URL should point to a search engine hosted by a web server
+# which will return the search results when EXTERNAL_SEARCH is enabled.
+# Doxygen ships with an example indexer (doxyindexer) and search engine
+# (doxysearch.cgi) which are based on the open source search engine library
+# Xapian (see: https://xapian.org/). See the section "External Indexing and
+# Searching" for details.
+# This tag requires that the tag SEARCHENGINE is set to YES.
+# When SERVER_BASED_SEARCH and EXTERNAL_SEARCH are both enabled the unindexed
+# search data is written to a file for indexing by an external tool. With the
+# SEARCHDATA_FILE tag the name of this file can be specified.
+# The default file is: searchdata.xml.
+# This tag requires that the tag SEARCHENGINE is set to YES.
+SEARCHDATA_FILE = searchdata.xml
+# When SERVER_BASED_SEARCH and EXTERNAL_SEARCH are both enabled the
+# EXTERNAL_SEARCH_ID tag can be used as an identifier for the project. This is
+# useful in combination with EXTRA_SEARCH_MAPPINGS to search through multiple
+# projects and redirect the results back to the right project.
+# This tag requires that the tag SEARCHENGINE is set to YES.
+# The EXTRA_SEARCH_MAPPINGS tag can be used to enable searching through doxygen
+# projects other than the one defined by this configuration file, but that are
+# all added to the same external search index. Each project needs to have a
+# unique id set via EXTERNAL_SEARCH_ID. The search mapping then maps the id of
+# to a relative location where the documentation can be found. The format is:
+# EXTRA_SEARCH_MAPPINGS = tagname1=loc1 tagname2=loc2 ...
+# This tag requires that the tag SEARCHENGINE is set to YES.
+# Configuration options related to the LaTeX output
+# If the GENERATE_LATEX tag is set to YES, doxygen will generate LaTeX output.
+# The default value is: YES.
+# The LATEX_OUTPUT tag is used to specify where the LaTeX docs will be put. If a
+# relative path is entered the value of OUTPUT_DIRECTORY will be put in front of
+# it.
+# The default directory is: latex.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# The LATEX_CMD_NAME tag can be used to specify the LaTeX command name to be
+# invoked.
+# Note that when enabling USE_PDFLATEX this option is only used for generating
+# bitmaps for formulas in the HTML output, but not in the Makefile that is
+# written to the output directory.
+# The default file is: latex.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# The MAKEINDEX_CMD_NAME tag can be used to specify the command name to generate
+# index for LaTeX.
+# The default file is: makeindex.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# If the COMPACT_LATEX tag is set to YES, doxygen generates more compact LaTeX
+# documents. This may be useful for small projects and may help to save some
+# trees in general.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# The PAPER_TYPE tag can be used to set the paper type that is used by the
+# printer.
+# Possible values are: a4 (210 x 297 mm), letter (8.5 x 11 inches), legal (8.5 x
+# 14 inches) and executive (7.25 x 10.5 inches).
+# The default value is: a4.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# The EXTRA_PACKAGES tag can be used to specify one or more LaTeX package names
+# that should be included in the LaTeX output. The package can be specified just
+# by its name or with the correct syntax as to be used with the LaTeX
+# \usepackage command. To get the times font for instance you can specify :
+# To use the option intlimits with the amsmath package you can specify:
+# EXTRA_PACKAGES=[intlimits]{amsmath}
+# If left blank no extra packages will be included.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# The LATEX_HEADER tag can be used to specify a personal LaTeX header for the
+# generated LaTeX document. The header should contain everything until the first
+# chapter. If it is left blank doxygen will generate a standard header. See
+# section "Doxygen usage" for information on how to let doxygen write the
+# default header to a separate file.
+# Note: Only use a user-defined header if you know what you are doing! The
+# following commands have a special meaning inside the header: $title,
+# $datetime, $date, $doxygenversion, $projectname, $projectnumber,
+# $projectbrief, $projectlogo. Doxygen will replace $title with the empty
+# string, for the replacement values of the other commands the user is referred
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# The LATEX_FOOTER tag can be used to specify a personal LaTeX footer for the
+# generated LaTeX document. The footer should contain everything after the last
+# chapter. If it is left blank doxygen will generate a standard footer. See
+# LATEX_HEADER for more information on how to generate a default footer and what
+# special commands can be used inside the footer.
+# Note: Only use a user-defined footer if you know what you are doing!
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# The LATEX_EXTRA_STYLESHEET tag can be used to specify additional user-defined
+# LaTeX style sheets that are included after the standard style sheets created
+# by doxygen. Using this option one can overrule certain style aspects. Doxygen
+# will copy the style sheet files to the output directory.
+# Note: The order of the extra style sheet files is of importance (e.g. the last
+# style sheet in the list overrules the setting of the previous ones in the
+# list).
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# The LATEX_EXTRA_FILES tag can be used to specify one or more extra images or
+# other source files which should be copied to the LATEX_OUTPUT output
+# directory. Note that the files will be copied as-is; there are no commands or
+# markers available.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# If the PDF_HYPERLINKS tag is set to YES, the LaTeX that is generated is
+# prepared for conversion to PDF (using ps2pdf or pdflatex). The PDF file will
+# contain links (just like the HTML output) instead of page references. This
+# makes the output suitable for online browsing using a PDF viewer.
+# The default value is: YES.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# If the USE_PDFLATEX tag is set to YES, doxygen will use pdflatex to generate
+# the PDF file directly from the LaTeX files. Set this option to YES, to get a
+# higher quality PDF documentation.
+# The default value is: YES.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# If the LATEX_BATCHMODE tag is set to YES, doxygen will add the \batchmode
+# command to the generated LaTeX files. This will instruct LaTeX to keep running
+# if errors occur, instead of asking the user for help. This option is also used
+# when generating formulas in HTML.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# If the LATEX_HIDE_INDICES tag is set to YES then doxygen will not include the
+# index chapters (such as File Index, Compound Index, etc.) in the output.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# If the LATEX_SOURCE_CODE tag is set to YES then doxygen will include source
+# code with syntax highlighting in the LaTeX output.
+# Note that which sources are shown also depends on other settings such as
+# The default value is: NO.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# The LATEX_BIB_STYLE tag can be used to specify the style to use for the
+# bibliography, e.g. plainnat, or ieeetr. See
+# https://en.wikipedia.org/wiki/BibTeX and \cite for more info.
+# The default value is: plain.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# If the LATEX_TIMESTAMP tag is set to YES then the footer of each generated
+# page will contain the date and time when the page was generated. Setting this
+# to NO can help when comparing the output of multiple runs.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+# Configuration options related to the RTF output
+# If the GENERATE_RTF tag is set to YES, doxygen will generate RTF output. The
+# RTF output is optimized for Word 97 and may not look too pretty with other RTF
+# readers/editors.
+# The default value is: NO.
+# The RTF_OUTPUT tag is used to specify where the RTF docs will be put. If a
+# relative path is entered the value of OUTPUT_DIRECTORY will be put in front of
+# it.
+# The default directory is: rtf.
+# This tag requires that the tag GENERATE_RTF is set to YES.
+# If the COMPACT_RTF tag is set to YES, doxygen generates more compact RTF
+# documents. This may be useful for small projects and may help to save some
+# trees in general.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_RTF is set to YES.
+# If the RTF_HYPERLINKS tag is set to YES, the RTF that is generated will
+# contain hyperlink fields. The RTF file will contain links (just like the HTML
+# output) instead of page references. This makes the output suitable for online
+# browsing using Word or some other Word compatible readers that support those
+# fields.
+# Note: WordPad (write) and others do not support links.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_RTF is set to YES.
+# Load stylesheet definitions from file. Syntax is similar to doxygen's config
+# file, i.e. a series of assignments. You only have to provide replacements,
+# missing definitions are set to their default value.
+# See also section "Doxygen usage" for information on how to generate the
+# default style sheet that doxygen normally uses.
+# This tag requires that the tag GENERATE_RTF is set to YES.
+# Set optional variables used in the generation of an RTF document. Syntax is
+# similar to doxygen's config file. A template extensions file can be generated
+# using doxygen -e rtf extensionFile.
+# This tag requires that the tag GENERATE_RTF is set to YES.
+# If the RTF_SOURCE_CODE tag is set to YES then doxygen will include source code
+# with syntax highlighting in the RTF output.
+# Note that which sources are shown also depends on other settings such as
+# The default value is: NO.
+# This tag requires that the tag GENERATE_RTF is set to YES.
+# Configuration options related to the man page output
+# If the GENERATE_MAN tag is set to YES, doxygen will generate man pages for
+# classes and files.
+# The default value is: NO.
+# The MAN_OUTPUT tag is used to specify where the man pages will be put. If a
+# relative path is entered the value of OUTPUT_DIRECTORY will be put in front of
+# it. A directory man3 will be created inside the directory specified by
+# The default directory is: man.
+# This tag requires that the tag GENERATE_MAN is set to YES.
+# The MAN_EXTENSION tag determines the extension that is added to the generated
+# man pages. In case the manual section does not start with a number, the number
+# 3 is prepended. The dot (.) at the beginning of the MAN_EXTENSION tag is
+# optional.
+# The default value is: .3.
+# This tag requires that the tag GENERATE_MAN is set to YES.
+# The MAN_SUBDIR tag determines the name of the directory created within
+# MAN_OUTPUT in which the man pages are placed. If defaults to man followed by
+# MAN_EXTENSION with the initial . removed.
+# This tag requires that the tag GENERATE_MAN is set to YES.
+# If the MAN_LINKS tag is set to YES and doxygen generates man output, then it
+# will generate one additional man file for each entity documented in the real
+# man page(s). These additional files only source the real man page, but without
+# them the man command would be unable to find the correct page.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_MAN is set to YES.
+# Configuration options related to the XML output
+# If the GENERATE_XML tag is set to YES, doxygen will generate an XML file that
+# captures the structure of the code including all documentation.
+# The default value is: NO.
+# The XML_OUTPUT tag is used to specify where the XML pages will be put. If a
+# relative path is entered the value of OUTPUT_DIRECTORY will be put in front of
+# it.
+# The default directory is: xml.
+# This tag requires that the tag GENERATE_XML is set to YES.
+# If the XML_PROGRAMLISTING tag is set to YES, doxygen will dump the program
+# listings (including syntax highlighting and cross-referencing information) to
+# the XML output. Note that enabling this will significantly increase the size
+# of the XML output.
+# The default value is: YES.
+# This tag requires that the tag GENERATE_XML is set to YES.
+# Configuration options related to the DOCBOOK output
+# If the GENERATE_DOCBOOK tag is set to YES, doxygen will generate Docbook files
+# that can be used to generate PDF.
+# The default value is: NO.
+# The DOCBOOK_OUTPUT tag is used to specify where the Docbook pages will be put.
+# If a relative path is entered the value of OUTPUT_DIRECTORY will be put in
+# front of it.
+# The default directory is: docbook.
+# This tag requires that the tag GENERATE_DOCBOOK is set to YES.
+# If the DOCBOOK_PROGRAMLISTING tag is set to YES, doxygen will include the
+# program listings (including syntax highlighting and cross-referencing
+# information) to the DOCBOOK output. Note that enabling this will significantly
+# increase the size of the DOCBOOK output.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_DOCBOOK is set to YES.
+# Configuration options for the AutoGen Definitions output
+# If the GENERATE_AUTOGEN_DEF tag is set to YES, doxygen will generate an
+# AutoGen Definitions (see http://autogen.sourceforge.net/) file that captures
+# the structure of the code including all documentation. Note that this feature
+# is still experimental and incomplete at the moment.
+# The default value is: NO.
+# Configuration options related to the Perl module output
+# If the GENERATE_PERLMOD tag is set to YES, doxygen will generate a Perl module
+# file that captures the structure of the code including all documentation.
+# Note that this feature is still experimental and incomplete at the moment.
+# The default value is: NO.
+# If the PERLMOD_LATEX tag is set to YES, doxygen will generate the necessary
+# Makefile rules, Perl scripts and LaTeX code to be able to generate PDF and DVI
+# output from the Perl module output.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_PERLMOD is set to YES.
+# If the PERLMOD_PRETTY tag is set to YES, the Perl module output will be nicely
+# formatted so it can be parsed by a human reader. This is useful if you want to
+# understand what is going on. On the other hand, if this tag is set to NO, the
+# size of the Perl module output will be much smaller and Perl will parse it
+# just the same.
+# The default value is: YES.
+# This tag requires that the tag GENERATE_PERLMOD is set to YES.
+# The names of the make variables in the generated doxyrules.make file are
+# prefixed with the string contained in PERLMOD_MAKEVAR_PREFIX. This is useful
+# so different doxyrules.make files included by the same Makefile don't
+# overwrite each other's variables.
+# This tag requires that the tag GENERATE_PERLMOD is set to YES.
+# Configuration options related to the preprocessor
+# If the ENABLE_PREPROCESSING tag is set to YES, doxygen will evaluate all
+# C-preprocessor directives found in the sources and include files.
+# The default value is: YES.
+# If the MACRO_EXPANSION tag is set to YES, doxygen will expand all macro names
+# in the source code. If set to NO, only conditional compilation will be
+# performed. Macro expansion can be done in a controlled way by setting
+# The default value is: NO.
+# This tag requires that the tag ENABLE_PREPROCESSING is set to YES.
+# If the EXPAND_ONLY_PREDEF and MACRO_EXPANSION tags are both set to YES then
+# the macro expansion is limited to the macros specified with the PREDEFINED and
+# The default value is: NO.
+# This tag requires that the tag ENABLE_PREPROCESSING is set to YES.
+# If the SEARCH_INCLUDES tag is set to YES, the include files in the
+# INCLUDE_PATH will be searched if a #include is found.
+# The default value is: YES.
+# This tag requires that the tag ENABLE_PREPROCESSING is set to YES.
+# The INCLUDE_PATH tag can be used to specify one or more directories that
+# contain include files that are not input files but should be processed by the
+# preprocessor.
+# This tag requires that the tag SEARCH_INCLUDES is set to YES.
+# You can use the INCLUDE_FILE_PATTERNS tag to specify one or more wildcard
+# patterns (like *.h and *.hpp) to filter out the header-files in the
+# directories. If left blank, the patterns specified with FILE_PATTERNS will be
+# used.
+# This tag requires that the tag ENABLE_PREPROCESSING is set to YES.
+# The PREDEFINED tag can be used to specify one or more macro names that are
+# defined before the preprocessor is started (similar to the -D option of e.g.
+# gcc). The argument of the tag is a list of macros of the form: name or
+# name=definition (no spaces). If the definition and the "=" are omitted, "=1"
+# is assumed. To prevent a macro definition from being undefined via #undef or
+# recursively expanded use the := operator instead of the = operator.
+# This tag requires that the tag ENABLE_PREPROCESSING is set to YES.
+# If the MACRO_EXPANSION and EXPAND_ONLY_PREDEF tags are set to YES then this
+# tag can be used to specify a list of macro names that should be expanded. The
+# macro definition that is found in the sources will be used. Use the PREDEFINED
+# tag if you want to use a different macro definition that overrules the
+# definition found in the source code.
+# This tag requires that the tag ENABLE_PREPROCESSING is set to YES.
+# If the SKIP_FUNCTION_MACROS tag is set to YES then doxygen's preprocessor will
+# remove all references to function-like macros that are alone on a line, have
+# an all uppercase name, and do not end with a semicolon. Such function macros
+# are typically used for boiler-plate code, and will confuse the parser if not
+# removed.
+# The default value is: YES.
+# This tag requires that the tag ENABLE_PREPROCESSING is set to YES.
+# Configuration options related to external references
+# The TAGFILES tag can be used to specify one or more tag files. For each tag
+# file the location of the external documentation should be added. The format of
+# a tag file without this location is as follows:
+# TAGFILES = file1 file2 ...
+# Adding location for the tag files is done as follows:
+# TAGFILES = file1=loc1 "file2 = loc2" ...
+# where loc1 and loc2 can be relative or absolute paths or URLs. See the
+# section "Linking to external documentation" for more information about the use
+# of tag files.
+# Note: Each tag file must have a unique name (where the name does NOT include
+# the path). If a tag file is not located in the directory in which doxygen is
+# run, you must also specify the path to the tagfile here.
+# When a file name is specified after GENERATE_TAGFILE, doxygen will create a
+# tag file that is based on the input files it reads. See section "Linking to
+# external documentation" for more information about the usage of tag files.
+# If the ALLEXTERNALS tag is set to YES, all external class will be listed in
+# the class index. If set to NO, only the inherited external classes will be
+# listed.
+# The default value is: NO.
+# If the EXTERNAL_GROUPS tag is set to YES, all external groups will be listed
+# in the modules index. If set to NO, only the current project's groups will be
+# listed.
+# The default value is: YES.
+# If the EXTERNAL_PAGES tag is set to YES, all external pages will be listed in
+# the related pages index. If set to NO, only the current project's pages will
+# be listed.
+# The default value is: YES.
+# The PERL_PATH should be the absolute path and name of the perl script
+# interpreter (i.e. the result of 'which perl').
+# The default file (with absolute path) is: /usr/bin/perl.
+PERL_PATH = /usr/bin/perl
+# Configuration options related to the dot tool
+# If the CLASS_DIAGRAMS tag is set to YES, doxygen will generate a class diagram
+# (in HTML and LaTeX) for classes with base or super classes. Setting the tag to
+# NO turns the diagrams off. Note that this option also works with HAVE_DOT
+# disabled, but it is recommended to install and use dot, since it yields more
+# powerful graphs.
+# The default value is: YES.
+# You can define message sequence charts within doxygen comments using the \msc
+# command. Doxygen will then run the mscgen tool (see:
+# http://www.mcternan.me.uk/mscgen/)) to produce the chart and insert it in the
+# documentation. The MSCGEN_PATH tag allows you to specify the directory where
+# the mscgen tool resides. If left empty the tool is assumed to be found in the
+# default search path.
+# You can include diagrams made with dia in doxygen documentation. Doxygen will
+# then run dia to produce the diagram and insert it in the documentation. The
+# DIA_PATH tag allows you to specify the directory where the dia binary resides.
+# If left empty dia is assumed to be found in the default search path.
+# If set to YES the inheritance and collaboration graphs will hide inheritance
+# and usage relations if the target is undocumented or is not a class.
+# The default value is: YES.
+# If you set the HAVE_DOT tag to YES then doxygen will assume the dot tool is
+# available from the path. This tool is part of Graphviz (see:
+# http://www.graphviz.org/), a graph visualization toolkit from AT&T and Lucent
+# Bell Labs. The other options in this section have no effect if this option is
+# set to NO
+# The default value is: NO.
+# The DOT_NUM_THREADS specifies the number of dot invocations doxygen is allowed
+# to run in parallel. When set to 0 doxygen will base this on the number of
+# processors available in the system. You can set it explicitly to a value
+# larger than 0 to get control over the balance between CPU load and processing
+# speed.
+# Minimum value: 0, maximum value: 32, default value: 0.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# When you want a differently looking font in the dot files that doxygen
+# generates you can specify the font name using DOT_FONTNAME. You need to make
+# sure dot is able to find the font, which can be done by putting it in a
+# standard location or by setting the DOTFONTPATH environment variable or by
+# setting DOT_FONTPATH to the directory containing the font.
+# The default value is: Helvetica.
+# This tag requires that the tag HAVE_DOT is set to YES.
+DOT_FONTNAME = Helvetica
+# The DOT_FONTSIZE tag can be used to set the size (in points) of the font of
+# dot graphs.
+# Minimum value: 4, maximum value: 24, default value: 10.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# By default doxygen will tell dot to use the default font as specified with
+# DOT_FONTNAME. If you specify a different font using DOT_FONTNAME you can set
+# the path where dot can find it using this tag.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# If the CLASS_GRAPH tag is set to YES then doxygen will generate a graph for
+# each documented class showing the direct and indirect inheritance relations.
+# Setting this tag to YES will force the CLASS_DIAGRAMS tag to NO.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# If the COLLABORATION_GRAPH tag is set to YES then doxygen will generate a
+# graph for each documented class showing the direct and indirect implementation
+# dependencies (inheritance, containment, and class references variables) of the
+# class with other documented classes.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# If the GROUP_GRAPHS tag is set to YES then doxygen will generate a graph for
+# groups, showing the direct groups dependencies.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# If the UML_LOOK tag is set to YES, doxygen will generate inheritance and
+# collaboration diagrams in a style similar to the OMG's Unified Modeling
+# Language.
+# The default value is: NO.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# If the UML_LOOK tag is enabled, the fields and methods are shown inside the
+# class node. If there are many fields or methods and many nodes the graph may
+# become too big to be useful. The UML_LIMIT_NUM_FIELDS threshold limits the
+# number of items for each type to make the size more manageable. Set this to 0
+# for no limit. Note that the threshold may be exceeded by 50% before the limit
+# is enforced. So when you set the threshold to 10, up to 15 fields may appear,
+# but if the number exceeds 15, the total amount of fields shown is limited to
+# 10.
+# Minimum value: 0, maximum value: 100, default value: 10.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# If the TEMPLATE_RELATIONS tag is set to YES then the inheritance and
+# collaboration graphs will show the relations between templates and their
+# instances.
+# The default value is: NO.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# YES then doxygen will generate a graph for each documented file showing the
+# direct and indirect include dependencies of the file with other documented
+# files.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# set to YES then doxygen will generate a graph for each documented file showing
+# the direct and indirect include dependencies of the file with other documented
+# files.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# If the CALL_GRAPH tag is set to YES then doxygen will generate a call
+# dependency graph for every global function or class method.
+# Note that enabling this option will significantly increase the time of a run.
+# So in most cases it will be better to enable call graphs for selected
+# functions only using the \callgraph command. Disabling a call graph can be
+# accomplished by means of the command \hidecallgraph.
+# The default value is: NO.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# If the CALLER_GRAPH tag is set to YES then doxygen will generate a caller
+# dependency graph for every global function or class method.
+# Note that enabling this option will significantly increase the time of a run.
+# So in most cases it will be better to enable caller graphs for selected
+# functions only using the \callergraph command. Disabling a caller graph can be
+# accomplished by means of the command \hidecallergraph.
+# The default value is: NO.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# If the GRAPHICAL_HIERARCHY tag is set to YES then doxygen will graphical
+# hierarchy of all classes instead of a textual one.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# If the DIRECTORY_GRAPH tag is set to YES then doxygen will show the
+# dependencies a directory has on other directories in a graphical way. The
+# dependency relations are determined by the #include relations between the
+# files in the directories.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# The DOT_IMAGE_FORMAT tag can be used to set the image format of the images
+# generated by dot. For an explanation of the image formats see the section
+# output formats in the documentation of the dot tool (Graphviz (see:
+# http://www.graphviz.org/)).
+# Note: If you choose svg you need to set HTML_FILE_EXTENSION to xhtml in order
+# to make the SVG files visible in IE 9+ (other browsers do not have this
+# requirement).
+# Possible values are: png, jpg, gif, svg, png:gd, png:gd:gd, png:cairo,
+# png:cairo:gd, png:cairo:cairo, png:cairo:gdiplus, png:gdiplus and
+# png:gdiplus:gdiplus.
+# The default value is: png.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# If DOT_IMAGE_FORMAT is set to svg, then this option can be set to YES to
+# enable generation of interactive SVG images that allow zooming and panning.
+# Note that this requires a modern browser other than Internet Explorer. Tested
+# and working are Firefox, Chrome, Safari, and Opera.
+# Note: For IE 9+ you need to set HTML_FILE_EXTENSION to xhtml in order to make
+# the SVG files visible. Older versions of IE do not have SVG support.
+# The default value is: NO.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# The DOT_PATH tag can be used to specify the path where the dot tool can be
+# found. If left blank, it is assumed the dot tool can be found in the path.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# The DOTFILE_DIRS tag can be used to specify one or more directories that
+# contain dot files that are included in the documentation (see the \dotfile
+# command).
+# This tag requires that the tag HAVE_DOT is set to YES.
+# The MSCFILE_DIRS tag can be used to specify one or more directories that
+# contain msc files that are included in the documentation (see the \mscfile
+# command).
+# The DIAFILE_DIRS tag can be used to specify one or more directories that
+# contain dia files that are included in the documentation (see the \diafile
+# command).
+# When using plantuml, the PLANTUML_JAR_PATH tag should be used to specify the
+# path where java can find the plantuml.jar file. If left blank, it is assumed
+# PlantUML is not used or called during a preprocessing step. Doxygen will
+# generate a warning when it encounters a \startuml command in this case and
+# will not generate output for the diagram.
+# When using plantuml, the PLANTUML_CFG_FILE tag can be used to specify a
+# configuration file for plantuml.
+# When using plantuml, the specified paths are searched for files specified by
+# the !include statement in a plantuml block.
+# The DOT_GRAPH_MAX_NODES tag can be used to set the maximum number of nodes
+# that will be shown in the graph. If the number of nodes in a graph becomes
+# larger than this value, doxygen will truncate the graph, which is visualized
+# by representing a node as a red box. Note that doxygen if the number of direct
+# children of the root node in a graph is already larger than
+# DOT_GRAPH_MAX_NODES then the graph will not be shown at all. Also note that
+# the size of a graph can be further restricted by MAX_DOT_GRAPH_DEPTH.
+# Minimum value: 0, maximum value: 10000, default value: 50.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# The MAX_DOT_GRAPH_DEPTH tag can be used to set the maximum depth of the graphs
+# generated by dot. A depth value of 3 means that only nodes reachable from the
+# root by following a path via at most 3 edges will be shown. Nodes that lay
+# further from the root node will be omitted. Note that setting this option to 1
+# or 2 may greatly reduce the computation time needed for large code bases. Also
+# note that the size of a graph can be further restricted by
+# DOT_GRAPH_MAX_NODES. Using a depth of 0 means no depth restriction.
+# Minimum value: 0, maximum value: 1000, default value: 0.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# Set the DOT_TRANSPARENT tag to YES to generate images with a transparent
+# background. This is disabled by default, because dot on Windows does not seem
+# to support this out of the box.
+# Warning: Depending on the platform used, enabling this option may lead to
+# badly anti-aliased labels on the edges of a graph (i.e. they become hard to
+# read).
+# The default value is: NO.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# Set the DOT_MULTI_TARGETS tag to YES to allow dot to generate multiple output
+# files in one run (i.e. multiple -o and -T options on the command line). This
+# makes dot run faster, but since only newer versions of dot (>1.8.10) support
+# this, this feature is disabled by default.
+# The default value is: NO.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# If the GENERATE_LEGEND tag is set to YES doxygen will generate a legend page
+# explaining the meaning of the various boxes and arrows in the dot generated
+# graphs.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
+# If the DOT_CLEANUP tag is set to YES, doxygen will remove the intermediate dot
+# files that are used to generate the various graphs.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
diff --git a/subprojects/d2tk/README.md b/subprojects/d2tk/README.md
new file mode 100644
index 0000000..63e12bc
--- /dev/null
+++ b/subprojects/d2tk/README.md
@@ -0,0 +1,62 @@
+# d2tk
+## Data Driven Tool Kit
+A performant, dyamic, immediate-mode GUI tool kit in C which partially renders
+on-change only by massively hashing-and-cashing of vector drawing instructions
+and on-demand rendered sprites.
+### Build / test
+ git clone https://git.open-music-kontrollers.ch/lad/d2tk
+ cd d2tk
+ meson build
+ cd build
+ ninja -j4
+#### Pugl/NanoVG backend
+ ./d2tk.nanovg
+#### Pugl/Cairo backend
+ ./d2tk.cairo
+#### FBdev/Cairo backend
+ ./d2tk.fbdev
+### Screenshots
+![Screenshot 1](https://git.open-music-kontrollers.ch/lad/d2tk/plain/screenshots/screenshot_1.png)
+![Screenshot 2](https://git.open-music-kontrollers.ch/lad/d2tk/plain/screenshots/screenshot_2.png)
+![Screenshot 3](https://git.open-music-kontrollers.ch/lad/d2tk/plain/screenshots/screenshot_3.png)
+![Screenshot 4](https://git.open-music-kontrollers.ch/lad/d2tk/plain/screenshots/screenshot_4.png)
+![Screenshot 5](https://git.open-music-kontrollers.ch/lad/d2tk/plain/screenshots/screenshot_5.png)
+![Screenshot 6](https://git.open-music-kontrollers.ch/lad/d2tk/plain/screenshots/screenshot_6.png)
+![Screenshot 7](https://git.open-music-kontrollers.ch/lad/d2tk/plain/screenshots/screenshot_7.png)
+![Screenshot 8](https://git.open-music-kontrollers.ch/lad/d2tk/plain/screenshots/screenshot_8.png)
+### License
+Copyright (c) 2018-2019 Hanspeter Portner (dev@open-music-kontrollers.ch)
+This is free software: you can redistribute it and/or modify
+it under the terms of the Artistic License 2.0 as published by
+The Perl Foundation.
+This source is distributed in the hope that it will be useful,
+but WITHOUT ANY WARRANTY; without even the implied warranty of
+Artistic License 2.0 for more details.
+You should have received a copy of the Artistic License 2.0
+along the source as a COPYING file. If not, obtain it from
diff --git a/subprojects/d2tk/VERSION b/subprojects/d2tk/VERSION
new file mode 100644
index 0000000..2ce9d83
--- /dev/null
+++ b/subprojects/d2tk/VERSION
@@ -0,0 +1 @@
diff --git a/subprojects/d2tk/d2tk/backend.h b/subprojects/d2tk/d2tk/backend.h
new file mode 100644
index 0000000..862f6d2
--- /dev/null
+++ b/subprojects/d2tk/d2tk/backend.h
@@ -0,0 +1,33 @@
+ * Copyright (c) 2018-2019 Hanspeter Portner (dev@open-music-kontrollers.ch)
+ *
+ * This is free software: you can redistribute it and/or modify
+ * it under the terms of the Artistic License 2.0 as published by
+ * The Perl Foundation.
+ *
+ * This source is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Artistic License 2.0 for more details.
+ *
+ * You should have received a copy of the Artistic License 2.0
+ * along the source as a COPYING file. If not, obtain it from
+ * http://www.perlfoundation.org/artistic_license_2_0.
+ */
+#ifndef _D2TK_BACKEND_H
+#define _D2TK_BACKEND_H
+#include <d2tk/core.h>
+#ifdef __cplusplus
+extern "C" {
+extern const d2tk_core_driver_t d2tk_core_driver;
+#ifdef __cplusplus
+#endif // _D2TK_BACKEND_H
diff --git a/subprojects/d2tk/d2tk/base.h b/subprojects/d2tk/d2tk/base.h
new file mode 100644
index 0000000..26cea3b
--- /dev/null
+++ b/subprojects/d2tk/d2tk/base.h
@@ -0,0 +1,603 @@
+ * Copyright (c) 2018-2019 Hanspeter Portner (dev@open-music-kontrollers.ch)
+ *
+ * This is free software: you can redistribute it and/or modify
+ * it under the terms of the Artistic License 2.0 as published by
+ * The Perl Foundation.
+ *
+ * This source is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Artistic License 2.0 for more details.
+ *
+ * You should have received a copy of the Artistic License 2.0
+ * along the source as a COPYING file. If not, obtain it from
+ * http://www.perlfoundation.org/artistic_license_2_0.
+ */
+#ifndef _D2TK_BASE_H
+#define _D2TK_BASE_H
+#include <stdlib.h>
+#include <d2tk/core.h>
+#ifdef __cplusplus
+extern "C" {
+typedef uint64_t d2tk_id_t;
+typedef struct _d2tk_pos_t d2tk_pos_t;
+typedef struct _d2tk_style_t d2tk_style_t;
+typedef struct _d2tk_table_t d2tk_table_t;
+typedef struct _d2tk_frame_t d2tk_frame_t;
+typedef struct _d2tk_layout_t d2tk_layout_t;
+typedef struct _d2tk_scrollbar_t d2tk_scrollbar_t;
+typedef struct _d2tk_flowmatrix_t d2tk_flowmatrix_t;
+typedef struct _d2tk_flowmatrix_node_t d2tk_flowmatrix_node_t;
+typedef struct _d2tk_flowmatrix_arc_t d2tk_flowmatrix_arc_t;
+typedef struct _d2tk_pane_t d2tk_pane_t;
+typedef struct _d2tk_base_t d2tk_base_t;
+struct _d2tk_pos_t {
+ d2tk_coord_t x;
+ d2tk_coord_t y;
+typedef enum _d2tk_triple_t {
+ D2TK_TRIPLE_ACTIVE = (1 << 0),
+ D2TK_TRIPLE_HOT = (1 << 1),
+ D2TK_TRIPLE_FOCUS = (1 << 2),
+} d2tk_triple_t;
+struct _d2tk_style_t {
+ const char *font_face;
+ uint32_t border_width;
+ uint32_t padding;
+ uint32_t rounding;
+ uint32_t bg_color;
+ uint32_t fill_color [D2TK_TRIPLE_MAX];
+ uint32_t stroke_color [D2TK_TRIPLE_MAX];
+ uint32_t text_color [D2TK_TRIPLE_MAX];
+typedef enum _d2tk_state_t {
+ D2TK_STATE_DOWN = (1 << 0),
+ D2TK_STATE_UP = (1 << 1),
+ D2TK_STATE_ACTIVE = (1 << 2),
+ D2TK_STATE_HOT = (1 << 3),
+ D2TK_STATE_FOCUS = (1 << 4),
+ D2TK_STATE_FOCUS_IN = (1 << 5),
+ D2TK_STATE_FOCUS_OUT = (1 << 6),
+ D2TK_STATE_SCROLL_DOWN = (1 << 7),
+ D2TK_STATE_SCROLL_UP = (1 << 8),
+ D2TK_STATE_SCROLL_LEFT = (1 << 9),
+ D2TK_STATE_SCROLL_RIGHT = (1 << 10),
+ D2TK_STATE_MOTION = (1 << 11),
+ D2TK_STATE_CHANGED = (1 << 12),
+ D2TK_STATE_ENTER = (1 << 13),
+ D2TK_STATE_OVER = (1 << 14)
+} d2tk_state_t;
+typedef enum _d2tk_flag_t {
+ D2TK_FLAG_SCROLL_Y = (1 << 0),
+ D2TK_FLAG_SCROLL_X = (1 << 1),
+ D2TK_FLAG_PANE_Y = (1 << 2),
+ D2TK_FLAG_PANE_X = (1 << 3),
+ D2TK_FLAG_LAYOUT_Y = (1 << 4),
+ D2TK_FLAG_LAYOUT_X = (1 << 5),
+ D2TK_FLAG_LAYOUT_REL = (1 << 6),
+ D2TK_FLAG_LAYOUT_ABS = (1 << 7),
+} d2tk_flag_t;
+#define D2TK_ID_IDX(IDX) ((d2tk_id_t)__LINE__ << 16) | (IDX)
+#define D2TK_ID_FILE_IDX(IDX) \
+ ((d2tk_id_t)d2tk_hash(__FILE__, -1) << 32) | D2TK_ID_IDX((IDX))
+#define D2TK_ID D2TK_ID_IDX(0)
+extern const size_t d2tk_table_sz;
+extern const size_t d2tk_frame_sz;
+extern const size_t d2tk_layout_sz;
+extern const size_t d2tk_scrollbar_sz;
+extern const size_t d2tk_flowmatrix_sz;
+extern const size_t d2tk_flowmatrix_node_sz;
+extern const size_t d2tk_flowmatrix_arc_sz;
+extern const size_t d2tk_pane_sz;
+D2TK_API d2tk_table_t *
+d2tk_table_begin(const d2tk_rect_t *rect, unsigned N, unsigned M,
+ d2tk_table_t *tab);
+D2TK_API bool
+d2tk_table_not_end(d2tk_table_t *tab);
+D2TK_API d2tk_table_t *
+d2tk_table_next(d2tk_table_t *tab);
+D2TK_API unsigned
+d2tk_table_get_index(d2tk_table_t *tab);
+D2TK_API unsigned
+d2tk_table_get_index_x(d2tk_table_t *tab);
+D2TK_API unsigned
+d2tk_table_get_index_y(d2tk_table_t *tab);
+D2TK_API const d2tk_rect_t *
+d2tk_table_get_rect(d2tk_table_t *tab);
+#define D2TK_BASE_TABLE(RECT, N, M, TAB) \
+ for(d2tk_table_t *(TAB) = d2tk_table_begin((RECT), (N), (M), \
+ alloca(d2tk_table_sz)); \
+ d2tk_table_not_end((TAB)); \
+ (TAB) = d2tk_table_next((TAB)))
+D2TK_API d2tk_frame_t *
+d2tk_frame_begin(d2tk_base_t *base, const d2tk_rect_t *rect,
+ ssize_t lbl_len, const char *lbl, d2tk_frame_t *frm);
+D2TK_API bool
+d2tk_frame_not_end(d2tk_frame_t *frm);
+D2TK_API d2tk_frame_t *
+d2tk_frame_next(d2tk_frame_t *frm);
+D2TK_API const d2tk_rect_t *
+d2tk_frame_get_rect(d2tk_frame_t *frm);
+ for(d2tk_frame_t *(FRM) = d2tk_frame_begin((BASE), (RECT), (LBL_LEN), (LBL), \
+ alloca(d2tk_frame_sz)); \
+ d2tk_frame_not_end((FRM)); \
+ (FRM) = d2tk_frame_next((FRM)))
+D2TK_API d2tk_layout_t *
+d2tk_layout_begin(const d2tk_rect_t *rect, unsigned N, const d2tk_coord_t *frac,
+ d2tk_flag_t flag, d2tk_layout_t *lay);
+D2TK_API bool
+d2tk_layout_not_end(d2tk_layout_t *lay);
+D2TK_API d2tk_layout_t *
+d2tk_layout_next(d2tk_layout_t *lay);
+D2TK_API unsigned
+d2tk_layout_get_index(d2tk_layout_t *lay);
+D2TK_API const d2tk_rect_t *
+d2tk_layout_get_rect(d2tk_layout_t *lay);
+ for(d2tk_layout_t *(LAY) = d2tk_layout_begin((RECT), (N), (FRAC), (FLAG), \
+ alloca(d2tk_layout_sz)); \
+ d2tk_layout_not_end((LAY)); \
+ (LAY) = d2tk_layout_next((LAY)))
+D2TK_API d2tk_scrollbar_t *
+d2tk_scrollbar_begin(d2tk_base_t *base, const d2tk_rect_t *rect, d2tk_id_t id,
+ d2tk_flag_t flags, int32_t hmax, int32_t vmax, int32_t hnum, int32_t vnum,
+ d2tk_scrollbar_t *scrollbar);
+D2TK_API bool
+d2tk_scrollbar_not_end(d2tk_scrollbar_t *scrollbar);
+D2TK_API d2tk_scrollbar_t *
+d2tk_scrollbar_next(d2tk_base_t *base, d2tk_scrollbar_t *scrollbar);
+D2TK_API float
+d2tk_scrollbar_get_offset_y(d2tk_scrollbar_t *scrollbar);
+D2TK_API float
+d2tk_scrollbar_get_offset_x(d2tk_scrollbar_t *scrollbar);
+D2TK_API const d2tk_rect_t *
+d2tk_scrollbar_get_rect(d2tk_scrollbar_t *scrollbar);
+ for(d2tk_scrollbar_t *(SCROLLBAR) = d2tk_scrollbar_begin((BASE), (RECT), \
+ (ID), (FLAGS), (HMAX), (VMAX), (HNUM), (VNUM), \
+ alloca(d2tk_scrollbar_sz)); \
+ d2tk_scrollbar_not_end((SCROLLBAR)); \
+ (SCROLLBAR) = d2tk_scrollbar_next((BASE), (SCROLLBAR)))
+D2TK_API d2tk_pane_t *
+d2tk_pane_begin(d2tk_base_t *base, const d2tk_rect_t *rect, d2tk_id_t id,
+ d2tk_flag_t flags, float fmin, float fmax, d2tk_pane_t *pane);
+D2TK_API bool
+d2tk_pane_not_end(d2tk_pane_t *pane);
+D2TK_API d2tk_pane_t *
+d2tk_pane_next(d2tk_pane_t *pane);
+D2TK_API float
+d2tk_pane_get_fraction(d2tk_pane_t *pane);
+D2TK_API unsigned
+d2tk_pane_get_index(d2tk_pane_t *pane);
+D2TK_API const d2tk_rect_t *
+d2tk_pane_get_rect(d2tk_pane_t *pane);
+ for(d2tk_pane_t *(PANE) = d2tk_pane_begin((BASE), (RECT), \
+ (ID), (FLAGS), (FMIN), (FMAX), alloca(d2tk_pane_sz)); \
+ d2tk_pane_not_end((PANE)); \
+ (PANE) = d2tk_pane_next((PANE)))
+D2TK_API void
+d2tk_clip_int32(int32_t min, int32_t *value, int32_t max);
+D2TK_API void
+d2tk_clip_int64(int64_t min, int64_t *value, int64_t max);
+D2TK_API void
+d2tk_clip_float(float min, float *value, float max);
+D2TK_API void
+d2tk_clip_double(double min, double *value, double max);
+D2TK_API bool
+d2tk_base_get_shift(d2tk_base_t *base);
+D2TK_API bool
+d2tk_base_get_ctrl(d2tk_base_t *base);
+D2TK_API bool
+d2tk_base_get_alt(d2tk_base_t *base);
+D2TK_API bool
+d2tk_base_get_mod(d2tk_base_t *base);
+D2TK_API bool
+d2tk_state_is_down(d2tk_state_t state);
+D2TK_API bool
+d2tk_state_is_up(d2tk_state_t state);
+D2TK_API bool
+d2tk_state_is_scroll_up(d2tk_state_t state);
+D2TK_API bool
+d2tk_state_is_scroll_down(d2tk_state_t state);
+D2TK_API bool
+d2tk_state_is_motion(d2tk_state_t state);
+D2TK_API bool
+d2tk_state_is_scroll_left(d2tk_state_t state);
+D2TK_API bool
+d2tk_state_is_scroll_right(d2tk_state_t state);
+D2TK_API bool
+d2tk_state_is_active(d2tk_state_t state);
+D2TK_API bool
+d2tk_state_is_hot(d2tk_state_t state);
+D2TK_API bool
+d2tk_state_is_focused(d2tk_state_t state);
+D2TK_API bool
+d2tk_state_is_focus_in(d2tk_state_t state);
+D2TK_API bool
+d2tk_state_is_focus_out(d2tk_state_t state);
+D2TK_API bool
+d2tk_state_is_changed(d2tk_state_t state);
+D2TK_API bool
+d2tk_state_is_enter(d2tk_state_t state);
+D2TK_API bool
+d2tk_state_is_over(d2tk_state_t state);
+D2TK_API bool
+d2tk_base_is_hit(d2tk_base_t *base, const d2tk_rect_t *rect);
+D2TK_API void
+d2tk_base_append_char(d2tk_base_t *base, int ch);
+D2TK_API d2tk_state_t
+d2tk_base_is_active_hot(d2tk_base_t *base, d2tk_id_t id,
+ const d2tk_rect_t *rect, d2tk_flag_t flags);
+D2TK_API void
+d2tk_base_cursor(d2tk_base_t *base, const d2tk_rect_t *rect);
+D2TK_API d2tk_state_t
+d2tk_base_button_label_image(d2tk_base_t *base, d2tk_id_t id, ssize_t lbl_len,
+ const char *lbl, ssize_t path_len, const char *path, const d2tk_rect_t *rect);
+#define d2tk_base_button_label_image_is_changed(...) \
+ d2tk_state_is_changed(d2tk_base_button_label_image(__VA_ARGS__))
+D2TK_API d2tk_state_t
+d2tk_base_button_label(d2tk_base_t *base, d2tk_id_t id, ssize_t lbl_len,
+ const char *lbl, const d2tk_rect_t *rect);
+#define d2tk_base_button_label_is_changed(...) \
+ d2tk_state_is_changed(d2tk_base_button_label(__VA_ARGS__))
+D2TK_API d2tk_state_t
+d2tk_base_button_image(d2tk_base_t *base, d2tk_id_t id, ssize_t path_len,
+ const char *path, const d2tk_rect_t *rect);
+#define d2tk_base_button_image_is_changed(...) \
+ d2tk_state_is_changed(d2tk_base_button_image(__VA_ARGS__))
+D2TK_API const d2tk_style_t *
+D2TK_API const d2tk_style_t *
+d2tk_base_get_style(d2tk_base_t *base);
+D2TK_API void
+d2tk_base_set_style(d2tk_base_t *base, const d2tk_style_t *style);
+D2TK_API void
+d2tk_base_set_default_style(d2tk_base_t *base);
+D2TK_API d2tk_state_t
+d2tk_base_button(d2tk_base_t *base, d2tk_id_t id, const d2tk_rect_t *rect);
+#define d2tk_base_button_is_changed(...) \
+ d2tk_state_is_changed(d2tk_base_button(__VA_ARGS__))
+D2TK_API d2tk_state_t
+d2tk_base_toggle_label(d2tk_base_t *base, d2tk_id_t id, ssize_t lbl_len,
+ const char *lbl, const d2tk_rect_t *rect, bool *value);
+#define d2tk_base_toggle_label_is_changed(...) \
+ d2tk_state_is_changed(d2tk_base_toggle_label(__VA_ARGS__))
+D2TK_API d2tk_state_t
+d2tk_base_toggle(d2tk_base_t *base, d2tk_id_t id, const d2tk_rect_t *rect,
+ bool *value);
+#define d2tk_base_toggle_is_changed(...) \
+ d2tk_state_is_changed(d2tk_base_toggle(__VA_ARGS__))
+D2TK_API d2tk_state_t
+d2tk_base_meter(d2tk_base_t *base, d2tk_id_t id, const d2tk_rect_t *rect,
+ int32_t *value);
+#define d2tk_base_meter_is_changed(...) \
+ d2tk_state_is_changed(d2tk_base_meter(__VA_ARGS__))
+D2TK_API d2tk_state_t
+d2tk_base_combo(d2tk_base_t *base, d2tk_id_t id, ssize_t nitms,
+ const char **itms, const d2tk_rect_t *rect, int32_t *value);
+#define d2tk_base_combo_is_changed(...) \
+ d2tk_state_is_changed(d2tk_base_combo(__VA_ARGS__))
+D2TK_API d2tk_state_t
+d2tk_base_text_field(d2tk_base_t *base, d2tk_id_t id, const d2tk_rect_t *rect,
+ size_t maxlen, char *value, d2tk_align_t align, const char *accept);
+#define d2tk_base_text_field_is_changed(...) \
+ d2tk_state_is_changed(d2tk_base_text_field(__VA_ARGS__))
+D2TK_API d2tk_state_t
+d2tk_base_label(d2tk_base_t *base, ssize_t lbl_len, const char *lbl,
+ float mul, const d2tk_rect_t *rect, d2tk_align_t align);
+D2TK_API d2tk_state_t
+d2tk_base_dial_bool(d2tk_base_t *base, d2tk_id_t id, const d2tk_rect_t *rect,
+ bool *value);
+#define d2tk_base_dial_bool_is_changed(...) \
+ d2tk_state_is_changed(d2tk_base_dial_bool(__VA_ARGS__))
+D2TK_API d2tk_state_t
+d2tk_base_dial_int32(d2tk_base_t *base, d2tk_id_t id, const d2tk_rect_t *rect,
+ int32_t min, int32_t *value, int32_t max);
+#define d2tk_base_dial_int32_is_changed(...) \
+ d2tk_state_is_changed(d2tk_base_dial_int32(__VA_ARGS__))
+D2TK_API d2tk_state_t
+d2tk_base_prop_int32(d2tk_base_t *base, d2tk_id_t id, const d2tk_rect_t *rect,
+ int32_t min, int32_t *value, int32_t max);
+#define d2tk_base_prop_int32_is_changed(...) \
+ d2tk_state_is_changed(d2tk_base_prop_int32(__VA_ARGS__))
+D2TK_API d2tk_state_t
+d2tk_base_dial_int64(d2tk_base_t *base, d2tk_id_t id, const d2tk_rect_t *rect,
+ int64_t min, int64_t *value, int64_t max);
+#define d2tk_base_dial_int64_is_changed(...) \
+ d2tk_state_is_changed(d2tk_base_dial_int64(__VA_ARGS__))
+D2TK_API d2tk_state_t
+d2tk_base_dial_float(d2tk_base_t *base, d2tk_id_t id, const d2tk_rect_t *rect,
+ float min, float *value, float max);
+#define d2tk_base_dial_float_is_changed(...) \
+ d2tk_state_is_changed(d2tk_base_dial_float(__VA_ARGS__))
+D2TK_API d2tk_state_t
+d2tk_base_prop_float(d2tk_base_t *base, d2tk_id_t id, const d2tk_rect_t *rect,
+ float min, float *value, float max);
+#define d2tk_base_prop_float_is_changed(...) \
+ d2tk_state_is_changed(d2tk_base_prop_float(__VA_ARGS__))
+D2TK_API d2tk_state_t
+d2tk_base_dial_double(d2tk_base_t *base, d2tk_id_t id, const d2tk_rect_t *rect,
+ double min, double *value, double max);
+#define d2tk_base_dial_double_is_changed(...) \
+ d2tk_state_is_changed(d2tk_base_dial_double(__VA_ARGS__))
+D2TK_API d2tk_flowmatrix_t *
+d2tk_flowmatrix_begin(d2tk_base_t *base, const d2tk_rect_t *rect, d2tk_id_t id,
+ d2tk_flowmatrix_t *flowmatrix);
+D2TK_API bool
+d2tk_flowmatrix_not_end(d2tk_flowmatrix_t *flowmatrix);
+D2TK_API d2tk_flowmatrix_t *
+d2tk_flowmatrix_next(d2tk_flowmatrix_t *flowmatrix);
+ for(d2tk_flowmatrix_t *(FLOWMATRIX) = d2tk_flowmatrix_begin((BASE), (RECT), \
+ (ID), alloca(d2tk_flowmatrix_sz)); \
+ d2tk_flowmatrix_not_end((FLOWMATRIX)); \
+ (FLOWMATRIX) = d2tk_flowmatrix_next((FLOWMATRIX)))
+D2TK_API void
+d2tk_flowmatrix_set_src(d2tk_flowmatrix_t *flowmatrix, d2tk_id_t id,
+ const d2tk_pos_t *pos);
+D2TK_API void
+d2tk_flowmatrix_set_dst(d2tk_flowmatrix_t *flowmatrix, d2tk_id_t id,
+ const d2tk_pos_t *pos);
+D2TK_API d2tk_flowmatrix_node_t *
+d2tk_flowmatrix_node_begin(d2tk_base_t *base, d2tk_flowmatrix_t *flowmatrix,
+ d2tk_pos_t *pos, d2tk_flowmatrix_node_t *node);
+D2TK_API bool
+d2tk_flowmatrix_node_not_end(d2tk_flowmatrix_node_t *node);
+D2TK_API d2tk_flowmatrix_node_t *
+d2tk_flowmatrix_node_next(d2tk_flowmatrix_node_t *node, d2tk_pos_t *pos,
+ const d2tk_state_t *state);
+D2TK_API const d2tk_rect_t *
+d2tk_flowmatrix_node_get_rect(d2tk_flowmatrix_node_t *node);
+ for(d2tk_flowmatrix_node_t *(NODE) = d2tk_flowmatrix_node_begin((BASE), (FLOWM), \
+ (POS), alloca(d2tk_flowmatrix_node_sz)); \
+ d2tk_flowmatrix_node_not_end((NODE)); \
+ (NODE) = d2tk_flowmatrix_node_next((NODE), (POS), (STATE)))
+D2TK_API d2tk_flowmatrix_arc_t *
+d2tk_flowmatrix_arc_begin(d2tk_base_t *base, d2tk_flowmatrix_t *flowmatrix,
+ unsigned N, unsigned M, const d2tk_pos_t *src, const d2tk_pos_t *dst,
+ d2tk_pos_t *pos, d2tk_flowmatrix_arc_t *arc);
+D2TK_API bool
+d2tk_flowmatrix_arc_not_end(d2tk_flowmatrix_arc_t *arc);
+D2TK_API d2tk_flowmatrix_arc_t *
+d2tk_flowmatrix_arc_next(d2tk_flowmatrix_arc_t *arc, d2tk_pos_t *pos,
+ const d2tk_state_t *state);
+D2TK_API unsigned
+d2tk_flowmatrix_arc_get_index(d2tk_flowmatrix_arc_t *arc);
+D2TK_API unsigned
+d2tk_flowmatrix_arc_get_index_x(d2tk_flowmatrix_arc_t *arc);
+D2TK_API unsigned
+d2tk_flowmatrix_arc_get_index_y(d2tk_flowmatrix_arc_t *arc);
+D2TK_API const d2tk_rect_t *
+d2tk_flowmatrix_arc_get_rect(d2tk_flowmatrix_arc_t *arc);
+ for(d2tk_flowmatrix_arc_t *(ARC) = d2tk_flowmatrix_arc_begin((BASE), (FLOWM), \
+ (N), (M), (SRC), (DST), (POS), alloca(d2tk_flowmatrix_arc_sz)); \
+ d2tk_flowmatrix_arc_not_end((ARC)); \
+ (ARC) = d2tk_flowmatrix_arc_next((ARC), (POS), (STATE)))
+D2TK_API d2tk_base_t *
+d2tk_base_new(const d2tk_core_driver_t *driver, void *data);
+D2TK_API void
+d2tk_base_set_ttls(d2tk_base_t *base, uint32_t sprites, uint32_t memcaches);
+D2TK_API void
+d2tk_base_free(d2tk_base_t *base);
+D2TK_API void
+d2tk_base_pre(d2tk_base_t *base);
+D2TK_API void
+d2tk_base_post(d2tk_base_t *base);
+D2TK_API void
+d2tk_base_set_again(d2tk_base_t *base);
+D2TK_API void
+d2tk_base_clear_focus(d2tk_base_t *base);
+D2TK_API bool
+d2tk_base_get_again(d2tk_base_t *base);
+D2TK_API void
+d2tk_base_set_mouse_l(d2tk_base_t *base, bool down);
+D2TK_API void
+d2tk_base_set_mouse_m(d2tk_base_t *base, bool down);
+D2TK_API void
+d2tk_base_set_mouse_r(d2tk_base_t *base, bool down);
+D2TK_API void
+d2tk_base_set_mouse_pos(d2tk_base_t *base, d2tk_coord_t x, d2tk_coord_t y);
+D2TK_API void
+d2tk_base_get_mouse_pos(d2tk_base_t *base, d2tk_coord_t *x, d2tk_coord_t *y);
+D2TK_API void
+d2tk_base_add_mouse_scroll(d2tk_base_t *base, int32_t dx, int32_t dy);
+D2TK_API void
+d2tk_base_set_shift(d2tk_base_t *base, bool down);
+D2TK_API void
+d2tk_base_set_ctrl(d2tk_base_t *base, bool down);
+D2TK_API void
+d2tk_base_set_alt(d2tk_base_t *base, bool down);
+D2TK_API void
+d2tk_base_set_left(d2tk_base_t *base, bool down);
+D2TK_API void
+d2tk_base_set_right(d2tk_base_t *base, bool down);
+D2TK_API void
+d2tk_base_set_up(d2tk_base_t *base, bool down);
+D2TK_API void
+d2tk_base_set_down(d2tk_base_t *base, bool down);
+D2TK_API void
+d2tk_base_set_dimensions(d2tk_base_t *base, d2tk_coord_t w, d2tk_coord_t h);
+D2TK_API void
+d2tk_base_get_dimensions(d2tk_base_t *base, d2tk_coord_t *w, d2tk_coord_t *h);
+#ifdef __cplusplus
+#endif // _D2TK_BASE_H
diff --git a/subprojects/d2tk/d2tk/core.h b/subprojects/d2tk/d2tk/core.h
new file mode 100644
index 0000000..1fec3f2
--- /dev/null
+++ b/subprojects/d2tk/d2tk/core.h
@@ -0,0 +1,203 @@
+ * Copyright (c) 2018-2019 Hanspeter Portner (dev@open-music-kontrollers.ch)
+ *
+ * This is free software: you can redistribute it and/or modify
+ * it under the terms of the Artistic License 2.0 as published by
+ * The Perl Foundation.
+ *
+ * This source is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Artistic License 2.0 for more details.
+ *
+ * You should have received a copy of the Artistic License 2.0
+ * along the source as a COPYING file. If not, obtain it from
+ * http://www.perlfoundation.org/artistic_license_2_0.
+ */
+#ifndef _D2TK_CORE_H
+#define _D2TK_CORE_H
+#include <stdint.h>
+#include <stdbool.h>
+#include <d2tk/d2tk.h>
+#ifdef __cplusplus
+extern "C" {
+typedef int32_t d2tk_coord_t;
+typedef struct _d2tk_rect_t d2tk_rect_t;
+typedef struct _d2tk_widget_t d2tk_widget_t;
+typedef struct _d2tk_point_t d2tk_point_t;
+typedef struct _d2tk_core_t d2tk_core_t;
+typedef struct _d2tk_core_driver_t d2tk_core_driver_t;
+typedef enum _d2tk_align_t {
+ D2TK_ALIGN_LEFT = (1 << 0),
+ D2TK_ALIGN_CENTER = (1 << 1),
+ D2TK_ALIGN_RIGHT = (1 << 2),
+ D2TK_ALIGN_TOP = (1 << 3),
+ D2TK_ALIGN_MIDDLE = (1 << 4),
+ D2TK_ALIGN_BOTTOM = (1 << 5)
+} d2tk_align_t;
+struct _d2tk_rect_t {
+ d2tk_coord_t x;
+ d2tk_coord_t y;
+ d2tk_coord_t w;
+ d2tk_coord_t h;
+struct _d2tk_point_t {
+ d2tk_coord_t x;
+ d2tk_coord_t y;
+#define D2TK_RECT(X, Y, W, H) \
+ ((d2tk_rect_t){ .x = (X), .y = (Y), .w = (W), .h = (H) })
+#define D2TK_POINT(X, Y) \
+ ((d2tk_point_t){ .x = (X), .y = (Y) })
+extern const size_t d2tk_widget_sz;
+D2TK_API void
+d2tk_rect_shrink_x(d2tk_rect_t *dst, const d2tk_rect_t *src,
+ d2tk_coord_t brd);
+D2TK_API void
+d2tk_rect_shrink_y(d2tk_rect_t *dst, const d2tk_rect_t *src,
+ d2tk_coord_t brd);
+D2TK_API void
+d2tk_rect_shrink(d2tk_rect_t *dst, const d2tk_rect_t *src,
+ d2tk_coord_t brd);
+D2TK_API void
+d2tk_core_move_to(d2tk_core_t *core, d2tk_coord_t x, d2tk_coord_t y);
+D2TK_API void
+d2tk_core_line_to(d2tk_core_t *core, d2tk_coord_t x, d2tk_coord_t y);
+D2TK_API void
+d2tk_core_rect(d2tk_core_t *core, const d2tk_rect_t *rect);
+D2TK_API void
+d2tk_core_rounded_rect(d2tk_core_t *core, const d2tk_rect_t *rect,
+ d2tk_coord_t r);
+D2TK_API void
+d2tk_core_arc(d2tk_core_t *core, d2tk_coord_t x, d2tk_coord_t y, d2tk_coord_t r,
+ d2tk_coord_t a, d2tk_coord_t b, bool cw);
+D2TK_API void
+d2tk_core_curve_to(d2tk_core_t *core, d2tk_coord_t x1, d2tk_coord_t y1,
+ d2tk_coord_t x2, d2tk_coord_t y2, d2tk_coord_t x3, d2tk_coord_t y3);
+D2TK_API void
+d2tk_core_color(d2tk_core_t *core, uint32_t rgba);
+D2TK_API void
+d2tk_core_linear_gradient(d2tk_core_t *core, const d2tk_point_t point [2],
+ const uint32_t rgba [2]);
+D2TK_API void
+d2tk_core_stroke(d2tk_core_t *core);
+D2TK_API void
+d2tk_core_fill(d2tk_core_t *core);
+D2TK_API void
+d2tk_core_save(d2tk_core_t *core);
+D2TK_API void
+d2tk_core_restore(d2tk_core_t *core);
+D2TK_API void
+d2tk_core_rotate(d2tk_core_t *core, d2tk_coord_t deg);
+D2TK_API d2tk_widget_t *
+d2tk_core_widget_begin(d2tk_core_t *core, uint64_t hash, d2tk_widget_t *widget);
+D2TK_API bool
+d2tk_core_widget_not_end(d2tk_core_t *core, d2tk_widget_t *widget);
+D2TK_API d2tk_widget_t *
+d2tk_core_widget_next(d2tk_core_t *core, d2tk_widget_t *widget);
+ for(d2tk_widget_t *(WIDGET) = d2tk_core_widget_begin((CORE), (HASH), \
+ alloca(d2tk_widget_sz)); \
+ d2tk_core_widget_not_end((CORE), (WIDGET)); \
+ (WIDGET) = d2tk_core_widget_next((CORE), (WIDGET)))
+D2TK_API ssize_t
+d2tk_core_bbox_push(d2tk_core_t *core, bool cached, const d2tk_rect_t *rect);
+D2TK_API ssize_t
+d2tk_core_bbox_container_push(d2tk_core_t *core, bool cached,
+ const d2tk_rect_t *rect);
+D2TK_API void
+d2tk_core_bbox_pop(d2tk_core_t *core, ssize_t ref);
+D2TK_API void
+d2tk_core_begin_path(d2tk_core_t *core);
+D2TK_API void
+d2tk_core_close_path(d2tk_core_t *core);
+D2TK_API void
+d2tk_core_scissor(d2tk_core_t *core, const d2tk_rect_t *rect);
+D2TK_API void
+d2tk_core_reset_scissor(d2tk_core_t *core);
+D2TK_API void
+d2tk_core_font_size(d2tk_core_t *core, d2tk_coord_t size);
+D2TK_API void
+d2tk_core_font_face(d2tk_core_t *core, size_t sz, const char *face);
+D2TK_API void
+d2tk_core_text(d2tk_core_t *core, const d2tk_rect_t *rect, size_t sz,
+ const char *text, d2tk_align_t align);
+D2TK_API void
+d2tk_core_image(d2tk_core_t *core, d2tk_rect_t *rect, size_t sz,
+ const char *path, d2tk_align_t align);
+D2TK_API void
+d2tk_core_stroke_width(d2tk_core_t *core, d2tk_coord_t width);
+D2TK_API void
+d2tk_core_pre(d2tk_core_t *core);
+D2TK_API void
+d2tk_core_post(d2tk_core_t *core);
+D2TK_API d2tk_core_t *
+d2tk_core_new(const d2tk_core_driver_t *driver, void *data);
+D2TK_API void
+d2tk_core_set_ttls(d2tk_core_t *core, uint32_t sprites, uint32_t memcaches);
+D2TK_API void
+d2tk_core_free(d2tk_core_t *core);
+D2TK_API void
+d2tk_core_set_dimensions(d2tk_core_t *core, d2tk_coord_t w, d2tk_coord_t h);
+D2TK_API void
+d2tk_core_get_dimensions(d2tk_core_t *core, d2tk_coord_t *w, d2tk_coord_t *h);
+#ifdef __cplusplus
+#endif // _D2TK_CORE_H
diff --git a/subprojects/d2tk/d2tk/d2tk.h b/subprojects/d2tk/d2tk/d2tk.h
new file mode 100644
index 0000000..2d12a82
--- /dev/null
+++ b/subprojects/d2tk/d2tk/d2tk.h
@@ -0,0 +1,23 @@
+ * Copyright (c) 2018-2019 Hanspeter Portner (dev@open-music-kontrollers.ch)
+ *
+ * This is free software: you can redistribute it and/or modify
+ * it under the terms of the Artistic License 2.0 as published by
+ * The Perl Foundation.
+ *
+ * This source is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Artistic License 2.0 for more details.
+ *
+ * You should have received a copy of the Artistic License 2.0
+ * along the source as a COPYING file. If not, obtain it from
+ * http://www.perlfoundation.org/artistic_license_2_0.
+ */
+#ifndef _D2TK_H
+#define _D2TK_H
+#define D2TK_API
+#endif /* _D2TK_H */
diff --git a/subprojects/d2tk/d2tk/frontend_fbdev.h b/subprojects/d2tk/d2tk/frontend_fbdev.h
new file mode 100644
index 0000000..06a2907
--- /dev/null
+++ b/subprojects/d2tk/d2tk/frontend_fbdev.h
@@ -0,0 +1,60 @@
+ * Copyright (c) 2018-2019 Hanspeter Portner (dev@open-music-kontrollers.ch)
+ *
+ * This is free software: you can redistribute it and/or modify
+ * it under the terms of the Artistic License 2.0 as published by
+ * The Perl Foundation.
+ *
+ * This source is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Artistic License 2.0 for more details.
+ *
+ * You should have received a copy of the Artistic License 2.0
+ * along the source as a COPYING file. If not, obtain it from
+ * http://www.perlfoundation.org/artistic_license_2_0.
+ */
+#include <signal.h>
+#include <d2tk/base.h>
+#ifdef __cplusplus
+extern "C" {
+typedef int (*d2tk_fbdev_expose_t)(void *data, d2tk_coord_t w, d2tk_coord_t h);
+typedef struct _d2tk_fbdev_t d2tk_fbdev_t;
+typedef struct _d2tk_fbdev_config_t d2tk_fbdev_config_t;
+struct _d2tk_fbdev_config_t {
+ const char *fb_device;
+ const char *bundle_path;
+ d2tk_fbdev_expose_t expose;
+ void *data;
+D2TK_API d2tk_fbdev_t *
+d2tk_fbdev_new(const d2tk_fbdev_config_t *config);
+D2TK_API void
+d2tk_fbdev_free(d2tk_fbdev_t *fbdev);
+D2TK_API int
+d2tk_fbdev_step(d2tk_fbdev_t *fbdev);
+D2TK_API void
+d2tk_fbdev_run(d2tk_fbdev_t *fbdev, const sig_atomic_t *done);
+D2TK_API d2tk_base_t *
+d2tk_fbdev_get_base(d2tk_fbdev_t *fbdev);
+#ifdef __cplusplus
diff --git a/subprojects/d2tk/d2tk/frontend_pugl.h b/subprojects/d2tk/d2tk/frontend_pugl.h
new file mode 100644
index 0000000..bb61980
--- /dev/null
+++ b/subprojects/d2tk/d2tk/frontend_pugl.h
@@ -0,0 +1,75 @@
+ * Copyright (c) 2018-2019 Hanspeter Portner (dev@open-music-kontrollers.ch)
+ *
+ * This is free software: you can redistribute it and/or modify
+ * it under the terms of the Artistic License 2.0 as published by
+ * The Perl Foundation.
+ *
+ * This source is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Artistic License 2.0 for more details.
+ *
+ * You should have received a copy of the Artistic License 2.0
+ * along the source as a COPYING file. If not, obtain it from
+ * http://www.perlfoundation.org/artistic_license_2_0.
+ */
+#include <signal.h>
+#include <d2tk/base.h>
+#ifdef __cplusplus
+extern "C" {
+typedef int (*d2tk_pugl_expose_t)(void *data, d2tk_coord_t w, d2tk_coord_t h);
+typedef struct _d2tk_pugl_t d2tk_pugl_t;
+typedef struct _d2tk_pugl_config_t d2tk_pugl_config_t;
+struct _d2tk_pugl_config_t {
+ uintptr_t parent;
+ const char *bundle_path;
+ d2tk_coord_t min_w;
+ d2tk_coord_t min_h;
+ d2tk_coord_t w;
+ d2tk_coord_t h;
+ bool fixed_size;
+ bool fixed_aspect;
+ d2tk_pugl_expose_t expose;
+ void *data;
+D2TK_API d2tk_pugl_t *
+d2tk_pugl_new(const d2tk_pugl_config_t *config, uintptr_t *widget);
+D2TK_API void
+d2tk_pugl_free(d2tk_pugl_t *dpugl);
+D2TK_API int
+d2tk_pugl_step(d2tk_pugl_t *dpugl);
+D2TK_API void
+d2tk_pugl_run(d2tk_pugl_t *dpugl, const sig_atomic_t *done);
+D2TK_API void
+d2tk_pugl_redisplay(d2tk_pugl_t *dpugl);
+D2TK_API int
+d2tk_pugl_resize(d2tk_pugl_t *dpugl, d2tk_coord_t w, d2tk_coord_t h);
+D2TK_API d2tk_base_t *
+d2tk_pugl_get_base(d2tk_pugl_t *dpugl);
+D2TK_API float
+#ifdef __cplusplus
+#endif // _D2TK_FRONTEND_PUGL_H
diff --git a/subprojects/d2tk/d2tk/hash.h b/subprojects/d2tk/d2tk/hash.h
new file mode 100644
index 0000000..fc8d70f
--- /dev/null
+++ b/subprojects/d2tk/d2tk/hash.h
@@ -0,0 +1,40 @@
+ * Copyright (c) 2018-2019 Hanspeter Portner (dev@open-music-kontrollers.ch)
+ *
+ * This is free software: you can redistribute it and/or modify
+ * it under the terms of the Artistic License 2.0 as published by
+ * The Perl Foundation.
+ *
+ * This source is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Artistic License 2.0 for more details.
+ *
+ * You should have received a copy of the Artistic License 2.0
+ * along the source as a COPYING file. If not, obtain it from
+ * http://www.perlfoundation.org/artistic_license_2_0.
+ */
+#ifndef _D2TK_MURMUR32_H
+#define _D2TK_MURMUR32_H
+#include <stdint.h>
+#include <unistd.h>
+#include <d2tk/d2tk.h>
+#ifdef __cplusplus
+extern "C" {
+D2TK_API uint64_t
+d2tk_hash(const void *data, ssize_t nbytes);
+D2TK_API uint64_t
+d2tk_hash_foreach(const void *data, ssize_t nbytes, ...) __attribute__((sentinel));
+#ifdef __cplusplus
+#endif // _D2TK_MURMUR32_H
diff --git a/subprojects/d2tk/example/d2tk_fbdev.c b/subprojects/d2tk/example/d2tk_fbdev.c
new file mode 100644
index 0000000..a6c9c26
--- /dev/null
+++ b/subprojects/d2tk/example/d2tk_fbdev.c
@@ -0,0 +1,225 @@
+ * Copyright (c) 2018-2019 Hanspeter Portner (dev@open-music-kontrollers.ch)
+ *
+ * This is free software: you can redistribute it and/or modify
+ * it under the terms of the Artistic License 2.0 as published by
+ * The Perl Foundation.
+ *
+ * This source is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Artistic License 2.0 for more details.
+ *
+ * You should have received a copy of the Artistic License 2.0
+ * along the source as a COPYING file. If not, obtain it from
+ * http://www.perlfoundation.org/artistic_license_2_0.
+ */
+#include <stdio.h>
+#include <stdlib.h>
+#include <inttypes.h>
+#include <unistd.h>
+#include <dirent.h>
+#include <string.h>
+#include <signal.h>
+#include <d2tk/frontend_fbdev.h>
+#include "example/example.h"
+#define AUTO "auto"
+typedef struct _app_t app_t;
+typedef void (*foreach_t)(const char *path, const char *d_name);
+struct _app_t {
+ d2tk_fbdev_t *fbdev;
+static sig_atomic_t done = false;
+static void
+_sig(int signum __attribute__((unused)))
+ done = true;
+static inline int
+_expose(void *data, d2tk_coord_t w, d2tk_coord_t h)
+ app_t *app = data;
+ d2tk_fbdev_t *fbdev = app->fbdev;
+ d2tk_base_t *base = d2tk_fbdev_get_base(fbdev);
+ d2tk_example_run(base, w, h);
+ d2tk_coord_t x = 0;
+ d2tk_coord_t y = 0;
+ d2tk_base_get_mouse_pos(base, &x, &y);
+ d2tk_base_cursor(base, &D2TK_RECT(x, y, 24, 24));
+ return EXIT_SUCCESS;
+static void
+_state(const char *path, const char *d_name, int32_t state)
+ char buf [PATH_MAX];
+ snprintf(buf, sizeof(buf), "%s/%s/bind", path, d_name);
+ FILE *f = fopen(buf, "w");
+ if(f)
+ {
+ fprintf(f, "%"PRIi32, state);
+ fflush(f);
+ fclose(f);
+ }
+static void
+_unbind(const char *path, const char *d_name)
+ _state(path, d_name, 0);
+static void
+_bind(const char *path, const char *d_name)
+ _state(path, d_name, 1);
+static void
+_find_by_format_foreach(const char *path, const char *fmt, void *val,
+ foreach_t foreach)
+ DIR *d = opendir(path);
+ if(d)
+ {
+ struct dirent *dir;
+ while( (dir = readdir(d)) )
+ {
+ if(!strcmp(dir->d_name, ".") || !strcmp(dir->d_name, ".."))
+ {
+ continue;
+ }
+ if(sscanf(dir->d_name, fmt, val) == 1)
+ {
+ foreach(path, dir->d_name);
+ }
+ }
+ closedir(d);
+ }
+static int
+_find_by_format(const char *path, const char *fmt, void *val, char *res)
+ int ret = EXIT_FAILURE;
+ DIR *d = opendir(path);
+ if(d)
+ {
+ struct dirent *dir;
+ while( (dir = readdir(d)) )
+ {
+ if(!strcmp(dir->d_name, ".") || !strcmp(dir->d_name, ".."))
+ {
+ continue;
+ }
+ if(sscanf(dir->d_name, fmt, val) == 1)
+ {
+ snprintf(res, PATH_MAX, "%s/%s", path, dir->d_name);
+ break;
+ }
+ }
+ closedir(d);
+ }
+ return ret;
+main(int argc, char **argv)
+ static app_t app;
+ static char fb_device [PATH_MAX] = AUTO;
+ int c;
+ while( (c = getopt(argc, argv, "f:")) != -1)
+ {
+ switch(c)
+ {
+ case 'f':
+ {
+ strncpy(fb_device, optarg, PATH_MAX-1);
+ } break;
+ default:
+ {
+ fprintf(stderr, "Usage: %s\n"
+ " -f fb_device (auto)\n\n",
+ argv[0]);
+ } return EXIT_FAILURE;
+ }
+ }
+ if(!strcmp(fb_device, AUTO))
+ {
+ uint32_t num;
+ if(_find_by_format("/dev", "fb%"SCNu32, &num, fb_device))
+ {
+ return EXIT_FAILURE;
+ }
+ }
+ fprintf(stdout,
+ " fb_device: %s\n\n",
+ fb_device);
+ const d2tk_fbdev_config_t config = {
+ .fb_device = fb_device,
+ .bundle_path = "./",
+ .expose = _expose,
+ .data = &app
+ };
+ signal(SIGINT, _sig);
+ signal(SIGTERM, _sig);
+#if !defined(_WIN32)
+ signal(SIGQUIT, _sig);
+ signal(SIGKILL, _sig);
+ app.fbdev = d2tk_fbdev_new(&config);
+ if(app.fbdev)
+ {
+ uint32_t num;
+ _find_by_format_foreach("/sys/class/vtconsole", "vtcon%"SCNu32, &num,
+ _unbind);
+ d2tk_example_init();
+ d2tk_fbdev_run(app.fbdev, &done);
+ d2tk_fbdev_free(app.fbdev);
+ d2tk_example_deinit();
+ _find_by_format_foreach("/sys/class/vtconsole", "vtcon%"SCNu32, &num,
+ _bind);
+ return EXIT_SUCCESS;
+ }
+ return EXIT_FAILURE;
diff --git a/subprojects/d2tk/example/d2tk_pugl.c b/subprojects/d2tk/example/d2tk_pugl.c
new file mode 100644
index 0000000..4c9bc2e
--- /dev/null
+++ b/subprojects/d2tk/example/d2tk_pugl.c
@@ -0,0 +1,121 @@
+ * Copyright (c) 2018-2019 Hanspeter Portner (dev@open-music-kontrollers.ch)
+ *
+ * This is free software: you can redistribute it and/or modify
+ * it under the terms of the Artistic License 2.0 as published by
+ * The Perl Foundation.
+ *
+ * This source is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Artistic License 2.0 for more details.
+ *
+ * You should have received a copy of the Artistic License 2.0
+ * along the source as a COPYING file. If not, obtain it from
+ * http://www.perlfoundation.org/artistic_license_2_0.
+ */
+#include <stdio.h>
+#include <stdlib.h>
+#include <inttypes.h>
+#include <unistd.h>
+#include <signal.h>
+#include <d2tk/frontend_pugl.h>
+#include "example/example.h"
+typedef struct _app_t app_t;
+struct _app_t {
+ d2tk_pugl_t *dpugl;
+static sig_atomic_t done = false;
+static void
+_sig(int signum __attribute__((unused)))
+ done = true;
+static int
+_expose(void *data, d2tk_coord_t w, d2tk_coord_t h)
+ app_t *app = data;
+ d2tk_pugl_t *dpugl = app->dpugl;
+ d2tk_base_t *base = d2tk_pugl_get_base(dpugl);
+ d2tk_example_run(base, w, h);
+ return EXIT_SUCCESS;
+main(int argc __attribute__((unused)), char **argv __attribute__((unused)))
+ static app_t app;
+ const float scale = d2tk_pugl_get_scale();
+ d2tk_coord_t w = scale * 1280;
+ d2tk_coord_t h = scale * 720;
+ int c;
+ while( (c = getopt(argc, argv, "w:h:")) != -1)
+ {
+ switch(c)
+ {
+ case 'w':
+ {
+ w = atoi(optarg);
+ } break;
+ case 'h':
+ {
+ h = atoi(optarg);
+ } break;
+ default:
+ {
+ fprintf(stderr, "Usage: %s\n"
+ " -w width\n"
+ " -h height\n\n",
+ argv[0]);
+ } return EXIT_FAILURE;
+ }
+ }
+ const d2tk_pugl_config_t config = {
+ .parent = 0,
+ .bundle_path = "./",
+ .min_w = w/4,
+ .min_h = h/4,
+ .w = w,
+ .h = h,
+ .fixed_size = false,
+ .fixed_aspect = false,
+ .expose = _expose,
+ .data = &app
+ };
+ signal(SIGINT, _sig);
+ signal(SIGTERM, _sig);
+#if !defined(_WIN32)
+ signal(SIGQUIT, _sig);
+ signal(SIGKILL, _sig);
+ app.dpugl = d2tk_pugl_new(&config, NULL);
+ if(app.dpugl)
+ {
+ d2tk_example_init();
+ d2tk_pugl_run(app.dpugl, &done);
+ d2tk_pugl_free(app.dpugl);
+ d2tk_example_deinit();
+ return EXIT_SUCCESS;
+ }
+ return EXIT_FAILURE;
diff --git a/subprojects/d2tk/example/example.c b/subprojects/d2tk/example/example.c
new file mode 100644
index 0000000..b2ccc06
--- /dev/null
+++ b/subprojects/d2tk/example/example.c
@@ -0,0 +1,1480 @@
+ * Copyright (c) 2018-2019 Hanspeter Portner (dev@open-music-kontrollers.ch)
+ *
+ * This is free software: you can redistribute it and/or modify
+ * it under the terms of the Artistic License 2.0 as published by
+ * The Perl Foundation.
+ *
+ * This source is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Artistic License 2.0 for more details.
+ *
+ * You should have received a copy of the Artistic License 2.0
+ * along the source as a COPYING file. If not, obtain it from
+ * http://www.perlfoundation.org/artistic_license_2_0.
+ */
+#include <stdio.h>
+#include <stdlib.h>
+#include <math.h>
+#include <inttypes.h>
+#include <dirent.h>
+#include <string.h>
+#include <d2tk/frontend_pugl.h>
+#include "example/example.h"
+#if !defined(_WIN32) && !defined(__APPLE__)
+# include <libevdev/libevdev.h>
+# include <libevdev/libevdev-uinput.h>
+typedef struct _fake_t fake_t;
+struct _fake_t {
+ struct libevdev *dev;
+ struct libevdev_uinput *uidev;
+static fake_t fake = {
+ .dev = NULL,
+ .uidev = NULL
+typedef union _val_t val_t;
+union _val_t {
+ bool b;
+ int32_t i;
+ int64_t h;
+ float f;
+ double d;
+ char s [32];
+typedef enum _bar_t {
+#if !defined(_WIN32) && !defined(__APPLE__)
+} bar_t;
+static bar_t bar = BAR_MIX;
+static const char *bar_lbl [BAR_MAX] = {
+ [BAR_MIX] = "Mix of many",
+ [BAR_SEQ] = "Sequencer",
+ [BAR_SCROLL] = "Scrollbar",
+ [BAR_PANE] = "Pane",
+ [BAR_LAYOUT] = "Layout",
+ [BAR_FLOWMATRIX] = "Flowmatrix",
+ [BAR_METER] = "Meter",
+ [BAR_FRAME] = "Frame",
+#if !defined(_WIN32) && !defined(__APPLE__)
+ [BAR_BROWSER] = "Browser",
+ [BAR_KEYBOARD] = "Keyboard"
+static inline void
+_render_c_mix(d2tk_base_t *base, const d2tk_rect_t *rect)
+#define N 12
+#define M 24
+ static val_t value [N*M];
+ D2TK_BASE_TABLE(rect, N, M, tab)
+ {
+ const unsigned k = d2tk_table_get_index(tab);
+ const d2tk_rect_t *bnd = d2tk_table_get_rect(tab);
+ const d2tk_id_t id = D2TK_ID_IDX(k);
+ val_t *val = &value[k];
+ switch(k % N)
+ {
+ case 0:
+ {
+ char lbl [32];
+ const size_t lbl_len = snprintf(lbl, sizeof(lbl), "%03X", k);
+ if(d2tk_base_toggle_label_is_changed(
+ base, id, lbl_len, lbl, bnd, &val->b))
+ {
+ fprintf(stdout, "toggle %016"PRIx64" %s\n", id, val->b ? "ON" : "OFF");
+ };
+ } break;
+ case 1:
+ {
+ char lbl [32];
+ const size_t lbl_len = snprintf(lbl, sizeof(lbl), "%03X", k);
+ if(d2tk_base_button_label_is_changed(
+ base, id, lbl_len, lbl, bnd))
+ {
+ fprintf(stdout, "button %016"PRIx64" DOWN\n", id);
+ }
+ } break;
+ case 2:
+ {
+ if(d2tk_base_dial_bool_is_changed(
+ base, id, bnd, &val->b))
+ {
+ fprintf(stdout, "dial %016"PRIx64" %s\n", id, val->b ? "ON" : "OFF");
+ }
+ } break;
+ case 3:
+ {
+ if(d2tk_base_dial_int32_is_changed(
+ base, id, bnd, -5, &val->i, 5))
+ {
+ fprintf(stdout, "dial %016"PRIx64" %"PRIi32"\n", id, val->i);
+ }
+ } break;
+ case 4:
+ {
+ if(d2tk_base_dial_int64_is_changed(
+ base, id, bnd, -10, &val->h, 10))
+ {
+ fprintf(stdout, "dial %016"PRIx64" %"PRIi64"\n", id, val->h);
+ }
+ } break;
+ case 5:
+ {
+ if(d2tk_base_dial_float_is_changed(
+ base, id, bnd, -1.f, &val->f, 1.f))
+ {
+ fprintf(stdout, "dial %016"PRIx64" %f\n", id, val->f);
+ }
+ } break;
+ case 6:
+ {
+ if(d2tk_base_dial_double_is_changed(
+ base, id, bnd, -10.0, &val->d, 10.0))
+ {
+ fprintf(stdout, "dial %016"PRIx64" %lf\n", id, val->d);
+ }
+ } break;
+ case 7:
+ {
+ if(d2tk_base_text_field_is_changed(
+ base, id, bnd, 32, val->s, D2TK_ALIGN_LEFT | D2TK_ALIGN_MIDDLE, NULL))
+ {
+ fprintf(stdout, "text %016"PRIx64" %s\n", id, val->s);
+ }
+ } break;
+ case 8:
+ {
+ if(d2tk_base_prop_int32_is_changed(
+ base, id, bnd, -5, &val->i, 5))
+ {
+ fprintf(stdout, "prop %016"PRIx64" %"PRIi32"\n", id, val->i);
+ }
+ } break;
+ case 9:
+ {
+ if(d2tk_base_prop_float_is_changed(
+ base, id, bnd, -1.f, &val->f, 1.f))
+ {
+ fprintf(stdout, "prop %016"PRIx64" %f\n", id, val->f);
+ }
+ } break;
+ case 10:
+ {
+ char lbl [32];
+ const size_t lbl_len = snprintf(lbl, sizeof(lbl), "%03X", k);
+ d2tk_base_label(base, lbl_len, lbl, 0.5f, bnd, D2TK_ALIGN_CENTERED);
+ } break;
+ case 11:
+ {
+#define NITMS 5
+ static const char *itms [NITMS] = {
+ "one",
+ "two",
+ "three",
+ "four",
+ "five"
+ };
+ if(d2tk_base_combo_is_changed(base, id, NITMS, itms, bnd, &val->i))
+ {
+ fprintf(stdout, "combo %016"PRIx64" %s (%"PRIi32")\n", id,
+ itms[val->i], val->i);
+ }
+#undef NITMS
+ } break;
+ default:
+ {
+ // nothing to do
+ } break;
+ }
+ }
+#undef M
+#undef N
+static inline void
+_render_c_seq(d2tk_base_t *base, const d2tk_rect_t *rect)
+#define N (8*12)
+#define NN (N*N)
+ const unsigned M = N * rect->h / rect->w;
+ static val_t value [N*N];
+ d2tk_style_t style = *d2tk_base_get_default_style();
+ style.border_width = 1;
+ style.padding = 0;
+ style.rounding = 0;
+ d2tk_base_set_style(base, &style);
+ D2TK_BASE_TABLE(rect, N, M, tab)
+ {
+ const unsigned k = d2tk_table_get_index(tab);
+ const unsigned x = d2tk_table_get_index_x(tab);
+ const unsigned y = d2tk_table_get_index_y(tab);
+ const d2tk_rect_t *bnd = d2tk_table_get_rect(tab);
+ const d2tk_id_t id = D2TK_ID_IDX(k);
+ if(k >= NN)
+ {
+ break;
+ }
+ val_t *val = &value[k];
+ if(y == 0)
+ {
+ char lbl [32];
+ const size_t lbl_len = snprintf(lbl, sizeof(lbl), "%u", x % 10);
+ d2tk_base_label(base, lbl_len, lbl, 1.f, bnd, D2TK_ALIGN_CENTERED);
+ continue;
+ }
+ else if(x == 0)
+ {
+ char lbl [32];
+ const size_t lbl_len = snprintf(lbl, sizeof(lbl), "%u", y % 10);
+ d2tk_base_label(base, lbl_len, lbl, 1.f, bnd, D2TK_ALIGN_CENTERED);
+ continue;
+ }
+ if(d2tk_base_toggle_is_changed(base, id, bnd, &val->b))
+ {
+ fprintf(stdout, "toggle %016"PRIx64" %s\n", id, val->b ? "ON" : "OFF");
+ }
+ }
+ d2tk_base_set_default_style(base);
+#undef NN
+#undef N
+static inline void
+_render_c_scroll(d2tk_base_t *base, const d2tk_rect_t *rect)
+#define N 12 // number of columns
+#define N_2 (N / 2) // number of visible columns
+#define M 512// total elements
+#define O 24 // elements per page
+ d2tk_style_t style = *d2tk_base_get_default_style();
+ N, 0, N_2, 0, hscroll)
+ {
+ const float hoffset = d2tk_scrollbar_get_offset_x(hscroll);
+ const d2tk_rect_t *row = d2tk_scrollbar_get_rect(hscroll);
+ D2TK_BASE_TABLE(row, N_2, 1, tcol)
+ {
+ const unsigned j = d2tk_table_get_index_x(tcol) + hoffset;
+ const d2tk_rect_t *col = d2tk_table_get_rect(tcol);
+ 0, M/(j+1), 0, O, vscroll)
+ {
+ const float voffset = d2tk_scrollbar_get_offset_y(vscroll);
+ const d2tk_rect_t *sub = d2tk_scrollbar_get_rect(vscroll);
+ d2tk_base_set_style(base, &style);
+ D2TK_BASE_TABLE(sub, 1, O, tlist)
+ {
+ const unsigned k = d2tk_table_get_index_y(tlist) + voffset;
+ const d2tk_rect_t *bnd = d2tk_table_get_rect(tlist);
+ const d2tk_id_t id = D2TK_ID_IDX(j*M + k + 1);
+ if(k % 2)
+ {
+ style.fill_color[D2TK_TRIPLE_NONE] = 0x4f4f4fff;
+ }
+ else
+ {
+ style.fill_color[D2TK_TRIPLE_NONE] = 0x3f3f3fff;
+ }
+ char lbl [32];
+ const size_t lbl_len = snprintf(lbl, sizeof(lbl), "%u-%03u", j, k);
+ if(d2tk_base_button_label_image_is_changed( base, id, lbl_len, lbl,
+ -1, "libre-arrow-circle-right.png", bnd))
+ {
+ fprintf(stdout, "button %016"PRIx64" DOWN\n", id);
+ }
+ }
+ d2tk_base_set_style(base, NULL);
+ }
+ }
+ }
+#undef N
+#undef N_2
+#undef M
+#undef O
+static inline void
+_render_c_pane(d2tk_base_t *base, const d2tk_rect_t *rect)
+ D2TK_BASE_PANE(base, rect, D2TK_ID, D2TK_FLAG_PANE_X, 0.1f, 0.9f, hpane)
+ {
+ const unsigned x = d2tk_pane_get_index(hpane);
+ const d2tk_rect_t *hrect = d2tk_pane_get_rect(hpane);
+ // 1st
+ if(x == 0)
+ {
+ if(d2tk_base_button_label_is_changed(base, D2TK_ID, -1, "1st", hrect))
+ {
+ fprintf(stdout, "button 1st DOWN\n");
+ }
+ continue;
+ }
+ // 2nd
+ D2TK_BASE_PANE(base, hrect, D2TK_ID, D2TK_FLAG_PANE_Y, 0.25f, 0.75f, vpane)
+ {
+ const unsigned y = d2tk_pane_get_index(vpane);
+ const d2tk_rect_t *vrect = d2tk_pane_get_rect(vpane);
+ // 1st
+ if(y == 0)
+ {
+ if(d2tk_base_button_label_is_changed(base, D2TK_ID, -1, "2nd", vrect))
+ {
+ fprintf(stdout, "button 2nd DOWN\n");
+ }
+ continue;
+ }
+ // 2nd
+ if(d2tk_base_button_label_is_changed(base, D2TK_ID, -1, "3rd", vrect))
+ {
+ fprintf(stdout, "button 3rd DOWN\n");
+ }
+ }
+ }
+static inline void
+_render_c_layout(d2tk_base_t *base, const d2tk_rect_t *rect)
+#define N 4
+ static const d2tk_coord_t hfrac [N] = { 4, 2, 1, 1 };
+ static const d2tk_coord_t vfrac [N] = { 100, 0, 0, 100};
+ D2TK_BASE_LAYOUT(rect, N, hfrac, D2TK_FLAG_LAYOUT_X_REL, hlay)
+ {
+ const d2tk_rect_t *hrect = d2tk_layout_get_rect(hlay);
+ const unsigned x = d2tk_layout_get_index(hlay);
+ switch(x)
+ {
+ case 0:
+ {
+ D2TK_BASE_LAYOUT(hrect, N, vfrac, D2TK_FLAG_LAYOUT_Y_ABS, vlay)
+ {
+ const d2tk_rect_t *vrect = d2tk_layout_get_rect(vlay);
+ const unsigned y = d2tk_layout_get_index(vlay);
+ char lbl [16];
+ const ssize_t lbl_len = snprintf(lbl, sizeof(lbl), "%"PRIu32, vfrac[y]);
+ if(d2tk_base_button_label_is_changed(base, D2TK_ID_IDX(x*N + y),
+ lbl_len, lbl, vrect))
+ {
+ fprintf(stdout, "button DOWN\n");
+ }
+ }
+ } break;
+ default:
+ {
+ char lbl [16];
+ const ssize_t lbl_len = snprintf(lbl, sizeof(lbl), "%"PRIu32, hfrac[x]);
+ if(d2tk_base_button_label_is_changed(base, D2TK_ID_IDX(x*N + 0),
+ lbl_len, lbl, hrect))
+ {
+ fprintf(stdout, "button DOWN\n");
+ }
+ }
+ }
+ }
+#undef N
+static inline void
+_render_c_flowmatrix(d2tk_base_t *base, const d2tk_rect_t *rect)
+#define N 4
+ static d2tk_pos_t pos_nodes [N] = {
+ [0] = { .x = -500, .y = 200 },
+ [1] = { .x = -250, .y = -100 },
+ [2] = { .x = 0, .y = 100 },
+ [3] = { .x = 500, .y = 0 }
+ };
+ static d2tk_pos_t pos_arcs [N][N] = {
+ [0] = {
+ [3] = { .x = 150, .y = 250 }
+ }
+ };
+ static bool value [N][N][N*N];
+ static bool toggle [N];
+ D2TK_BASE_FLOWMATRIX(base, rect, D2TK_ID, flowm)
+ {
+ // draw arcs
+ for(unsigned i = 0; i < N; i++)
+ {
+ const unsigned nin = i + 1;
+ for(unsigned j = i + 1; j < N; j++)
+ {
+ const unsigned nout = j + 1;
+ d2tk_state_t state = D2TK_STATE_NONE;
+ D2TK_BASE_FLOWMATRIX_ARC(base, flowm, nin, nout, &pos_nodes[i],
+ &pos_nodes[j], &pos_arcs[i][j], arc, &state)
+ {
+ const d2tk_rect_t *bnd = d2tk_flowmatrix_arc_get_rect(arc);
+ const unsigned k = d2tk_flowmatrix_arc_get_index(arc);
+ const d2tk_id_t id = D2TK_ID_IDX((i*N + j)*N*N + k);
+ const unsigned x = d2tk_flowmatrix_arc_get_index_x(arc);
+ const unsigned y = d2tk_flowmatrix_arc_get_index_y(arc);
+ if(y == nout) // source label
+ {
+ char lbl [16];
+ const ssize_t lbl_len = snprintf(lbl, sizeof(lbl), "Source port %u", x);
+ d2tk_base_label(base, lbl_len, lbl, 0.8f, bnd,
+ }
+ else if(x == nin) // sink label
+ {
+ char lbl [16];
+ const ssize_t lbl_len = snprintf(lbl, sizeof(lbl), "Sink port %u", y);
+ d2tk_base_label(base, lbl_len, lbl, 0.8f, bnd,
+ }
+ else // connector
+ {
+ bool *val = &value[i][j][k];
+ state = d2tk_base_dial_bool(base, id, bnd, val);
+ if(d2tk_state_is_changed(state))
+ {
+ fprintf(stderr, "Arc %u/%u %s\n", x, y, *val ? "ON" : "OFF");
+ }
+ }
+ }
+ }
+ }
+ // draw nodes
+ for(unsigned i = 0; i < N; i++)
+ {
+ d2tk_state_t state = D2TK_STATE_NONE;
+ D2TK_BASE_FLOWMATRIX_NODE(base, flowm, &pos_nodes[i], node, &state)
+ {
+ char lbl [32];
+ const ssize_t lbl_len = snprintf(lbl, sizeof(lbl), "Node %u", i);
+ const d2tk_rect_t *bnd = d2tk_flowmatrix_node_get_rect(node);
+ const d2tk_id_t id = D2TK_ID_IDX(i);
+ bool *val = &toggle[i];
+ state = d2tk_base_toggle_label(base, id, lbl_len, lbl, bnd, val);
+ if(d2tk_state_is_active(state))
+ {
+ fprintf(stderr, "Connecting from node %u\n", i);
+ d2tk_flowmatrix_set_src(flowm, id, &pos_nodes[i]);
+ }
+ if(d2tk_state_is_over(state))
+ {
+ fprintf(stderr, "Connecting to node %u\n", i);
+ d2tk_flowmatrix_set_dst(flowm, id, &pos_nodes[i]);
+ }
+ state = D2TK_STATE_NONE;
+ //else if(d2tk_state_is_changed(state))
+ //{
+ // fprintf(stderr, "Node %u %s\n", i, *val ? "ON" : "OFF");
+ //}
+ }
+ }
+ }
+#undef N
+static inline void
+_render_c_meter(d2tk_base_t *base, const d2tk_rect_t *rect)
+#define N 4
+#define M 40
+ d2tk_coord_t x = 0;
+ d2tk_coord_t y = 0;
+ d2tk_coord_t w = 0;
+ d2tk_coord_t h = 0;
+ d2tk_base_get_mouse_pos(base, &x, &y);
+ d2tk_base_get_dimensions(base, &w, &h);
+ const float fx = (float)x / w;
+ const float fy = (float)y / h;
+ D2TK_BASE_TABLE(rect, N, M, tab)
+ {
+ const unsigned k = d2tk_table_get_index(tab);
+ const unsigned a = d2tk_table_get_index_x(tab);
+ const unsigned b = d2tk_table_get_index_y(tab);
+ const d2tk_rect_t *bnd = d2tk_table_get_rect(tab);
+ const d2tk_id_t id = D2TK_ID_IDX(k);
+ const float fa = (float)a / N;
+ const float fb = (float)b / M;
+ const float dx = fa - fx;
+ const float dy = fb - fy;
+ const float dz = 1.f - sqrtf(dx*dx + dy*dy)*M_SQRT1_2;
+ int32_t val = -54 + 60*dz;
+ if(d2tk_base_meter_is_changed(base, id, bnd, &val))
+ {
+ // nothing to do, yet
+ }
+ }
+#undef M
+#undef N
+static inline void
+_render_c_frame(d2tk_base_t *base, const d2tk_rect_t *rect)
+#define N 4
+ static bool val [N];
+ D2TK_BASE_TABLE(rect, N, N, tab)
+ {
+ const d2tk_rect_t *bnd_outer = d2tk_table_get_rect(tab);
+ const unsigned k = d2tk_table_get_index(tab);
+ char lbl [32];
+ const ssize_t lbl_len = snprintf(lbl, sizeof(lbl), "This is frame #%u", k);
+ D2TK_BASE_FRAME(base, bnd_outer, lbl_len, lbl, frm)
+ {
+ const d2tk_rect_t *bnd_inner = d2tk_frame_get_rect(frm);
+ const d2tk_id_t id = D2TK_ID_IDX(k);
+ if(d2tk_base_dial_bool_is_changed(base, id, bnd_inner, &val[k]))
+ {
+ fprintf(stdout, "dial %016"PRIx64" %s\n", id, val[k] ? "ON" : "OFF");
+ }
+ }
+ }
+#if !defined(_WIN32) && !defined(__APPLE__)
+static int
+strcasenumcmp(const char *s1, const char *s2)
+ static const char *digits = "1234567890";
+ const char *d1 = strpbrk(s1, digits);
+ const char *d2 = strpbrk(s2, digits);
+ // do both s1 and s2 contain digits?
+ if(d1 && d2)
+ {
+ const size_t l1 = d1 - s1;
+ const size_t l2 = d2 - s2;
+ // do both s1 and s2 match up to the first digit?
+ if( (l1 == l2) && (strncmp(s1, s2, l1) == 0) )
+ {
+ char *e1 = NULL;
+ char *e2 = NULL;
+ const int n1 = strtol(d1, &e1, 10);
+ const int n2 = strtol(d2, &e2, 10);
+ // do both d1 and d2 contain a valid number?
+ if(e1 && e2)
+ {
+ // are the numbers equal? do the same for the substring
+ if(n1 == n2)
+ {
+ return strcasenumcmp(e1, e2);
+ }
+ // the numbers differ, e.g. return their ordering
+ return (n1 < n2) ? -1 : 1;
+ }
+ }
+ }
+ // no digits in either s1 or s2, do normal comparison
+ return strcasecmp(s1, s2);
+static int
+_file_list_sort(const void *a, const void *b)
+ const struct dirent *A = (const struct dirent *)a;
+ const struct dirent *B = (const struct dirent *)b;
+ const bool a_is_dir = (A->d_type == DT_DIR);
+ const bool b_is_dir = (B->d_type == DT_DIR);
+ if(a_is_dir && !b_is_dir)
+ {
+ return -1;
+ }
+ else if(!a_is_dir && b_is_dir)
+ {
+ return 1;
+ }
+ return strcasenumcmp(A->d_name, B->d_name);
+static struct dirent *
+_file_list_new(const char *path, size_t *num, bool return_hidden)
+ struct dirent *list = NULL;
+ *num = 0;
+ DIR *dir = opendir(path);
+ if(dir)
+ {
+ struct dirent *itm;
+ while( (itm = readdir(dir)) )
+ {
+ if(itm->d_name[0] == '.')
+ {
+ if( !return_hidden
+ || ( (itm->d_name[1] == '\0') || (itm->d_name[1] == '.') ) )
+ {
+ continue;
+ }
+ }
+ list = realloc(list, (*num+1) * sizeof(struct dirent));
+ memcpy(&list[*num], itm, sizeof(struct dirent));
+ *num += 1;
+ }
+ closedir(dir);
+ }
+ if(list)
+ {
+ qsort(list, *num, sizeof(struct dirent), _file_list_sort);
+ return list;
+ }
+ return NULL;
+static void
+_file_list_free(struct dirent *list)
+ free(list);
+static inline void
+_render_c_browser(d2tk_base_t *base, const d2tk_rect_t *rect)
+ static char root [PATH_MAX] = "";
+ if(strlen(root) == 0)
+ {
+ snprintf(root, sizeof(root), "%s/", getenv("HOME"));
+ }
+#define M 30
+ size_t nlist;
+ struct dirent *list = _file_list_new(root, &nlist, false);
+ d2tk_style_t style = *d2tk_base_get_default_style();
+ D2TK_BASE_TABLE(rect, 2, 1, brow)
+ {
+ const unsigned r = d2tk_table_get_index(brow);
+ const d2tk_rect_t *col = d2tk_table_get_rect(brow);
+ switch(r)
+ {
+ case 0:
+ {
+ size_t ndir = 0;
+ const char *ptr = root;
+ for(const char *nxt = strchr(root, '/');
+ nxt;
+ nxt = strchr(nxt + 1, '/'))
+ {
+ ndir++;
+ }
+ 0, ndir, 0, M, vscroll)
+ {
+ const float voffset = d2tk_scrollbar_get_offset_y(vscroll);
+ const d2tk_rect_t *row = d2tk_scrollbar_get_rect(vscroll);
+ d2tk_base_set_style(base, &style);
+ D2TK_BASE_TABLE(row, 1, M, tab)
+ {
+ const unsigned k = d2tk_table_get_index(tab) + voffset;
+ const d2tk_rect_t *bnd = d2tk_table_get_rect(tab);
+ if(k >= ndir)
+ {
+ break;
+ }
+ char *nxt = strchr(ptr, '/');
+ if(!nxt)
+ {
+ break;
+ }
+ nxt++;
+ style.fill_color[D2TK_TRIPLE_NONE] = k % 2
+ ? 0x4f4f4fff
+ : 0x3f3f3fff;
+ const char *icon = "libre-gui-folder.png";
+ if(d2tk_base_button_label_image_is_changed(base,
+ D2TK_ID_IDX(k), nxt - ptr, ptr, -1, icon, bnd))
+ {
+ *nxt = '\0';
+ }
+ ptr = nxt;
+ }
+ d2tk_base_set_style(base, NULL);
+ }
+ } break;
+ case 1:
+ {
+ 0, nlist, 0, M, vscroll)
+ {
+ const float voffset = d2tk_scrollbar_get_offset_y(vscroll);
+ const d2tk_rect_t *row = d2tk_scrollbar_get_rect(vscroll);
+ d2tk_base_set_style(base, &style);
+ D2TK_BASE_TABLE(row, 1, M, tab)
+ {
+ const unsigned k = d2tk_table_get_index(tab) + voffset;
+ const d2tk_rect_t *bnd = d2tk_table_get_rect(tab);
+ if(k >= nlist)
+ {
+ break;
+ }
+ style.fill_color[D2TK_TRIPLE_NONE] = k % 2
+ ? 0x4f4f4fff
+ : 0x3f3f3fff;
+ struct dirent *itm = &list[k];
+ const bool is_dir = (itm->d_type == DT_DIR);
+ const char *icon = is_dir
+ ? "libre-gui-folder.png"
+ : "libre-gui-file.png";
+ if(d2tk_base_button_label_image_is_changed(base,
+ D2TK_ID_IDX(k), -1, itm->d_name, -1, icon, bnd))
+ {
+ if(is_dir)
+ {
+ strncat(root, itm->d_name, sizeof(root) - strlen(root) - 1);
+ strncat(root, "/", sizeof(root) - strlen(root) - 1);
+ d2tk_base_clear_focus(base);
+ }
+ }
+ }
+ d2tk_base_set_style(base, NULL);
+ }
+ } break;
+ }
+ }
+ _file_list_free(list);
+#undef M
+static void
+_fake_event(unsigned type, unsigned code, int value)
+ if(fake.uidev)
+ {
+ libevdev_uinput_write_event(fake.uidev, type, code, value);
+ }
+static void
+_fake_key_down(unsigned keycode)
+ _fake_event(EV_KEY, keycode, 1);
+ _fake_event(EV_SYN, SYN_REPORT, 0);
+static void
+_fake_key_up(unsigned keycode)
+ _fake_event(EV_KEY, keycode, 0);
+ _fake_event(EV_SYN, SYN_REPORT, 0);
+typedef struct _keybtn_t keybtn_t;
+struct _keybtn_t {
+ const char *name;
+ const char *altn;
+ unsigned code;
+ float rect [4];
+#define W (1.f / 15.f)
+#define W_2 (W / 2)
+#define H (1.f / 6.f)
+static const keybtn_t keybtns [] = {
+ // row 1
+ {
+ .name = "Esc",
+ .code = KEY_ESC,
+ .rect = { 0*W, 0*H, W + W_2, H }
+ },
+ {
+ .name = "F1",
+ .code = KEY_F1,
+ .rect = { 1*W + W_2, 0*H, W, H }
+ },
+ {
+ .name = "F2",
+ .code = KEY_F2,
+ .rect = { 2*W + W_2, 0*H, W, H }
+ },
+ {
+ .name = "F3",
+ .code = KEY_F3,
+ .rect = { 3*W + W_2, 0*H, W, H }
+ },
+ {
+ .name = "F4",
+ .code = KEY_F4,
+ .rect = { 4*W + W_2, 0*H, W, H }
+ },
+ {
+ .name = "F5",
+ .code = KEY_F5,
+ .rect = { 5*W + W_2, 0*H, W, H }
+ },
+ {
+ .name = "F6",
+ .code = KEY_F6,
+ .rect = { 6*W + W_2, 0*H, W, H }
+ },
+ {
+ .name = "F7",
+ .code = KEY_F7,
+ .rect = { 7*W + W_2, 0*H, W, H }
+ },
+ {
+ .name = "F8",
+ .code = KEY_F8,
+ .rect = { 8*W + W_2, 0*H, W, H }
+ },
+ {
+ .name = "F9",
+ .code = KEY_F9,
+ .rect = { 9*W + W_2, 0*H, W, H }
+ },
+ {
+ .name = "F10",
+ .code = KEY_F10,
+ .rect = { 10*W + W_2, 0*H, W, H }
+ },
+ {
+ .name = "F11",
+ .code = KEY_F11,
+ .rect = { 11*W + W_2, 0*H, W, H }
+ },
+ {
+ .name = "F12",
+ .code = KEY_F12,
+ .rect = { 12*W + W_2, 0*H, W, H }
+ },
+ {
+ .name = "Delete",
+ .code = KEY_DELETE,
+ .rect = { 13*W + W_2, 0*H, W + W_2, H }
+ },
+ // row 2
+ {
+ .name = "`",
+ .altn = "~",
+ .code = KEY_GRAVE,
+ .rect = { 0*W, 1*H, W, H }
+ },
+ {
+ .name = "1",
+ .altn = "!",
+ .code = KEY_1,
+ .rect = { 1*W, 1*H, W, H }
+ },
+ {
+ .name = "2",
+ .altn = "@",
+ .code = KEY_2,
+ .rect = { 2*W, 1*H, W, H }
+ },
+ {
+ .name = "3",
+ .altn = "#",
+ .code = KEY_3,
+ .rect = { 3*W, 1*H, W, H }
+ },
+ {
+ .name = "4",
+ .altn = "$",
+ .code = KEY_4,
+ .rect = { 4*W, 1*H, W, H }
+ },
+ {
+ .name = "5",
+ .altn = "%",
+ .code = KEY_5,
+ .rect = { 5*W, 1*H, W, H }
+ },
+ {
+ .name = "6",
+ .altn = "^",
+ .code = KEY_6,
+ .rect = { 6*W, 1*H, W, H }
+ },
+ {
+ .name = "7",
+ .altn = "&",
+ .code = KEY_7,
+ .rect = { 7*W, 1*H, W, H }
+ },
+ {
+ .name = "8",
+ .altn = "*",
+ .code = KEY_8,
+ .rect = { 8*W, 1*H, W, H }
+ },
+ {
+ .name = "9",
+ .altn = "(",
+ .code = KEY_9,
+ .rect = { 9*W, 1*H, W, H }
+ },
+ {
+ .name = "0",
+ .altn = ")",
+ .code = KEY_0,
+ .rect = { 10*W, 1*H, W, H }
+ },
+ {
+ .name = "-",
+ .altn = "_",
+ .code = KEY_MINUS,
+ .rect = { 11*W, 1*H, W, H }
+ },
+ {
+ .name = "=",
+ .altn = "+",
+ .code = KEY_EQUAL,
+ .rect = { 12*W, 1*H, W, H }
+ },
+ {
+ .name = "Back",
+ .code = KEY_BACKSPACE,
+ .rect = { 13*W, 1*H, 2*W, H }
+ },
+ // row 3
+ {
+ .name = "Tab",
+ .code = KEY_TAB,
+ .rect = { 0*W, 2*H, W + W_2, H }
+ },
+ {
+ .name = "Q",
+ .code = KEY_Q,
+ .rect = { 1*W + W_2, 2*H, W, H }
+ },
+ {
+ .name = "W",
+ .code = KEY_W,
+ .rect = { 2*W + W_2, 2*H, W, H }
+ },
+ {
+ .name = "E",
+ .code = KEY_E,
+ .rect = { 3*W + W_2, 2*H, W, H }
+ },
+ {
+ .name = "R",
+ .code = KEY_R,
+ .rect = { 4*W + W_2, 2*H, W, H }
+ },
+ {
+ .name = "T",
+ .code = KEY_T,
+ .rect = { 5*W + W_2, 2*H, W, H }
+ },
+ {
+ .name = "Y",
+ .code = KEY_Y,
+ .rect = { 6*W + W_2, 2*H, W, H }
+ },
+ {
+ .name = "U",
+ .code = KEY_U,
+ .rect = { 7*W + W_2, 2*H, W, H }
+ },
+ {
+ .name = "I",
+ .code = KEY_I,
+ .rect = { 8*W + W_2, 2*H, W, H }
+ },
+ {
+ .name = "O",
+ .code = KEY_O,
+ .rect = { 9*W + W_2, 2*H, W, H }
+ },
+ {
+ .name = "P",
+ .code = KEY_P,
+ .rect = { 10*W + W_2, 2*H, W, H }
+ },
+ {
+ .name = "[",
+ .altn = "{",
+ .code = KEY_LEFTBRACE,
+ .rect = { 11*W + W_2, 2*H, W, H }
+ },
+ {
+ .name = "]",
+ .altn = "}",
+ .rect = { 12*W + W_2, 2*H, W, H }
+ },
+ {
+ .name = "\\",
+ .altn = "|",
+ .code = KEY_BACKSLASH,
+ .rect = { 13*W + W_2, 2*H, 2*W - W_2, H }
+ },
+ // row 4
+ {
+ .name = "Caps",
+ .code = KEY_CAPSLOCK,
+ .rect = { 0*W, 3*H, W*2, H }
+ },
+ {
+ .name = "A",
+ .code = KEY_A,
+ .rect = { 2*W, 3*H, W, H }
+ },
+ {
+ .name = "S",
+ .code = KEY_S,
+ .rect = { 3*W, 3*H, W, H }
+ },
+ {
+ .name = "D",
+ .code = KEY_D,
+ .rect = { 4*W, 3*H, W, H }
+ },
+ {
+ .name = "F",
+ .code = KEY_F,
+ .rect = { 5*W, 3*H, W, H }
+ },
+ {
+ .name = "G",
+ .code = KEY_G,
+ .rect = { 6*W, 3*H, W, H }
+ },
+ {
+ .name = "H",
+ .code = KEY_H,
+ .rect = { 7*W, 3*H, W, H }
+ },
+ {
+ .name = "J",
+ .code = KEY_J,
+ .rect = { 8*W, 3*H, W, H }
+ },
+ {
+ .name = "K",
+ .code = KEY_K,
+ .rect = { 9*W, 3*H, W, H }
+ },
+ {
+ .name = "L",
+ .code = KEY_L,
+ .rect = { 10*W, 3*H, W, H }
+ },
+ {
+ .name = ";",
+ .altn = ":",
+ .code = KEY_SEMICOLON,
+ .rect = { 11*W, 3*H, W, H }
+ },
+ {
+ .name = "'",
+ .altn = "\"",
+ .rect = { 12*W, 3*H, W, H }
+ },
+ {
+ .name = "Enter",
+ .code = KEY_ENTER,
+ .rect = { 13*W, 3*H, W*2, H }
+ },
+ // row 5
+ {
+ .name = "Shift",
+ .code = KEY_LEFTSHIFT,
+ .rect = { 0*W, 4*H, W*2 + W_2, H }
+ },
+ {
+ .name = "Z",
+ .code = KEY_Z,
+ .rect = { 2*W + W_2, 4*H, W, H }
+ },
+ {
+ .name = "X",
+ .code = KEY_X,
+ .rect = { 3*W + W_2, 4*H, W, H }
+ },
+ {
+ .name = "C",
+ .code = KEY_C,
+ .rect = { 4*W + W_2, 4*H, W, H }
+ },
+ {
+ .name = "V",
+ .code = KEY_V,
+ .rect = { 5*W + W_2, 4*H, W, H }
+ },
+ {
+ .name = "B",
+ .code = KEY_B,
+ .rect = { 6*W + W_2, 4*H, W, H }
+ },
+ {
+ .name = "N",
+ .code = KEY_N,
+ .rect = { 7*W + W_2, 4*H, W, H }
+ },
+ {
+ .name = "M",
+ .code = KEY_M,
+ .rect = { 8*W + W_2, 4*H, W, H }
+ },
+ {
+ .name = ",",
+ .altn = "<",
+ .code = KEY_COMMA,
+ .rect = { 9*W + W_2, 4*H, W, H }
+ },
+ {
+ .name = ".",
+ .altn = ">",
+ .code = KEY_DOT,
+ .rect = { 10*W + W_2, 4*H, W, H }
+ },
+ {
+ .name = "/",
+ .altn = "?",
+ .code = KEY_SLASH,
+ .rect = { 11*W + W_2, 4*H, W, H }
+ },
+ {
+ .name = "Shift",
+ .rect = { 12*W + W_2, 4*H, 3*W - W_2, H }
+ },
+ // row 6
+ {
+ .name = "Fn",
+ .code = KEY_FN,
+ .rect = { 0*W, 5*H, W, H }
+ },
+ {
+ .name = "Ctrl",
+ .code = KEY_LEFTCTRL,
+ .rect = { 1*W, 5*H, W, H }
+ },
+ {
+ .name = "Mta",
+ .code = KEY_LEFTMETA,
+ .rect = { 2*W, 5*H, W, H }
+ },
+ {
+ .name = "Alt",
+ .code = KEY_LEFTALT,
+ .rect = { 3*W, 5*H, W, H }
+ },
+ {
+ .name = "Space",
+ .code = KEY_SPACE,
+ .rect = { 4*W, 5*H, 5*W, H }
+ },
+ {
+ .name = "Alt",
+ .code = KEY_RIGHTALT,
+ .rect = { 9*W, 5*H, W, H }
+ },
+ {
+ .name = "Mta",
+ .code = KEY_RIGHTMETA,
+ .rect = { 10*W, 5*H, W, H }
+ },
+ {
+ .name = "Ctrl",
+ .code = KEY_RIGHTCTRL,
+ .rect = { 11*W, 5*H, W, H }
+ },
+ {
+ .name = "Hom",
+ .code = KEY_HOME,
+ .rect = { 12*W, 5*H, W, H }
+ },
+ {
+ .name = "End",
+ .code = KEY_END,
+ .rect = { 13*W, 5*H, W, H }
+ },
+ {
+ .name = "Ins",
+ .code = KEY_INSERT,
+ .rect = { 14*W, 5*H, W, H }
+ },
+ { // sentinel
+ .name = NULL
+ }
+static inline void
+_render_c_keyboard(d2tk_base_t *base, const d2tk_rect_t *rect)
+ for(const keybtn_t *keybtn = keybtns; keybtn->name; keybtn++)
+ {
+ const d2tk_rect_t bnd = {
+ .x = rect->x + keybtn->rect[0]*rect->w,
+ .y = rect->y + keybtn->rect[1]*rect->h,
+ .w = keybtn->rect[2]*rect->w,
+ .h = keybtn->rect[3]*rect->h
+ };
+ const char *lbl = d2tk_base_get_shift(base) && keybtn->altn
+ ? keybtn->altn
+ : keybtn->name;
+ const d2tk_state_t state = d2tk_base_button_label(base,
+ D2TK_ID_IDX(keybtn-keybtns), -1, lbl, &bnd);
+ if(d2tk_state_is_down(state))
+ {
+ _fake_key_down(keybtn->code);
+ }
+ else if(d2tk_state_is_up(state))
+ {
+ _fake_key_up(keybtn->code);
+ }
+ }
+D2TK_API int
+#if !defined(_WIN32) && !defined(__APPLE__)
+ fake.dev = libevdev_new();
+ if(!fake.dev)
+ {
+ fprintf(stderr, "Error: libevdev_new\n");
+ return EXIT_FAILURE;;
+ }
+ libevdev_set_name(fake.dev, "Fake keyboard");
+ libevdev_enable_event_type(fake.dev, EV_SYN);
+ libevdev_enable_event_code(fake.dev, EV_SYN, SYN_REPORT, NULL);
+ libevdev_enable_event_type(fake.dev, EV_KEY);
+ for(const keybtn_t *keybtn = keybtns; keybtn->name; keybtn++)
+ {
+ libevdev_enable_event_code(fake.dev, EV_KEY, keybtn->code, NULL);
+ }
+ fake.uidev = NULL;
+ libevdev_uinput_create_from_device(fake.dev, LIBEVDEV_UINPUT_OPEN_MANAGED,
+ &fake.uidev);
+ if(!fake.uidev)
+ {
+ fprintf(stderr, "Warning: libevdev_uinput_create_from_device\n");
+ return EXIT_FAILURE;
+ }
+ return EXIT_SUCCESS;
+D2TK_API void
+#if !defined(_WIN32) && !defined(__APPLE__)
+ if(fake.uidev)
+ {
+ libevdev_uinput_destroy(fake.uidev);
+ }
+ if(fake.dev)
+ {
+ libevdev_free(fake.dev);
+ }
+D2TK_API void
+d2tk_example_run(d2tk_base_t *base, d2tk_coord_t w, d2tk_coord_t h)
+ static d2tk_coord_t vfrac [2] = { 1, 19 };
+ d2tk_base_set_ttls(base, 0x10, 0x100);
+ D2TK_BASE_LAYOUT(&D2TK_RECT(0, 0, w, h), 2, vfrac, D2TK_FLAG_LAYOUT_Y_REL, vlay)
+ {
+ const d2tk_rect_t *vrect = d2tk_layout_get_rect(vlay);
+ const unsigned y = d2tk_layout_get_index(vlay);
+ switch(y)
+ {
+ case 0:
+ {
+ D2TK_BASE_TABLE(vrect, BAR_MAX, 1, tab)
+ {
+ const d2tk_rect_t *hrect = d2tk_table_get_rect(tab);
+ const unsigned b = d2tk_table_get_index(tab);
+ bool val = (b == bar);
+ d2tk_base_toggle_label(base, D2TK_ID_IDX(b), -1, bar_lbl[b], hrect, &val);
+ if(val)
+ {
+ bar = b;
+ }
+ }
+ } break;
+ case 1:
+ {
+ switch(bar)
+ {
+ case BAR_MIX:
+ {
+ _render_c_mix(base, vrect);
+ } break;
+ case BAR_SEQ:
+ {
+ _render_c_seq(base, vrect);
+ } break;
+ case BAR_SCROLL:
+ {
+ _render_c_scroll(base, vrect);
+ } break;
+ case BAR_PANE:
+ {
+ _render_c_pane(base, vrect);
+ } break;
+ case BAR_LAYOUT:
+ {
+ _render_c_layout(base, vrect);
+ } break;
+ {
+ _render_c_flowmatrix(base, vrect);
+ } break;
+ case BAR_METER:
+ {
+ _render_c_meter(base, vrect);
+ } break;
+ case BAR_FRAME:
+ {
+ _render_c_frame(base, vrect);
+ } break;
+#if !defined(_WIN32) && !defined(__APPLE__)
+ {
+ _render_c_browser(base, vrect);
+ } break;
+ {
+ _render_c_keyboard(base, vrect);
+ } break;
+ case BAR_MAX:
+ // fall-through
+ default:
+ {
+ // do nothing
+ } break;
+ }
+ }
+ }
+ }
diff --git a/subprojects/d2tk/example/example.h b/subprojects/d2tk/example/example.h
new file mode 100644
index 0000000..84f430c
--- /dev/null
+++ b/subprojects/d2tk/example/example.h
@@ -0,0 +1,40 @@
+ * Copyright (c) 2018-2019 Hanspeter Portner (dev@open-music-kontrollers.ch)
+ *
+ * This is free software: you can redistribute it and/or modify
+ * it under the terms of the Artistic License 2.0 as published by
+ * The Perl Foundation.
+ *
+ * This source is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Artistic License 2.0 for more details.
+ *
+ * You should have received a copy of the Artistic License 2.0
+ * along the source as a COPYING file. If not, obtain it from
+ * http://www.perlfoundation.org/artistic_license_2_0.
+ */
+#ifndef _D2TK_EXAMPLE_H
+#define _D2TK_EXAMPLE_H
+#include <d2tk/base.h>
+#ifdef __cplusplus
+extern "C" {
+D2TK_API int
+D2TK_API void
+D2TK_API void
+d2tk_example_run(d2tk_base_t *base, d2tk_coord_t w, d2tk_coord_t h);
+#ifdef __cplusplus
+#endif // _D2TK_EXAMPLE_H
diff --git a/subprojects/d2tk/example/libre-arrow-circle-right.png b/subprojects/d2tk/example/libre-arrow-circle-right.png
new file mode 100644
index 0000000..21c8013
--- /dev/null
+++ b/subprojects/d2tk/example/libre-arrow-circle-right.png
Binary files differ
diff --git a/subprojects/d2tk/example/libre-gui-file.png b/subprojects/d2tk/example/libre-gui-file.png
new file mode 100644
index 0000000..1c6d984
--- /dev/null
+++ b/subprojects/d2tk/example/libre-gui-file.png
Binary files differ
diff --git a/subprojects/d2tk/example/libre-gui-folder.png b/subprojects/d2tk/example/libre-gui-folder.png
new file mode 100644
index 0000000..6960606
--- /dev/null
+++ b/subprojects/d2tk/example/libre-gui-folder.png
Binary files differ
diff --git a/subprojects/d2tk/glew-2.1.0/GL/eglew.h b/subprojects/d2tk/glew-2.1.0/GL/eglew.h
new file mode 100644
index 0000000..4670147
--- /dev/null
+++ b/subprojects/d2tk/glew-2.1.0/GL/eglew.h
@@ -0,0 +1,2618 @@
+** The OpenGL Extension Wrangler Library
+** Copyright (C) 2008-2017, Nigel Stewart <nigels[]users sourceforge net>
+** Copyright (C) 2002-2008, Milan Ikits <milan ikits[]ieee org>
+** Copyright (C) 2002-2008, Marcelo E. Magallon <mmagallo[]debian org>
+** Copyright (C) 2002, Lev Povalahev
+** All rights reserved.
+** Redistribution and use in source and binary forms, with or without
+** modification, are permitted provided that the following conditions are met:
+** * Redistributions of source code must retain the above copyright notice,
+** this list of conditions and the following disclaimer.
+** * Redistributions in binary form must reproduce the above copyright notice,
+** this list of conditions and the following disclaimer in the documentation
+** and/or other materials provided with the distribution.
+** * The name of the author may be used to endorse or promote products
+** derived from this software without specific prior written permission.
+ * Mesa 3-D graphics library
+ * Version: 7.0
+ *
+ * Copyright (C) 1999-2007 Brian Paul All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the "Software"),
+ * to deal in the Software without restriction, including without limitation
+ * the rights to use, copy, modify, merge, publish, distribute, sublicense,
+ * and/or sell copies of the Software, and to permit persons to whom the
+ * Software is furnished to do so, subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included
+ * in all copies or substantial portions of the Software.
+ *
+ */
+** Copyright (c) 2007 The Khronos Group Inc.
+** Permission is hereby granted, free of charge, to any person obtaining a
+** copy of this software and/or associated documentation files (the
+** "Materials"), to deal in the Materials without restriction, including
+** without limitation the rights to use, copy, modify, merge, publish,
+** distribute, sublicense, and/or sell copies of the Materials, and to
+** permit persons to whom the Materials are furnished to do so, subject to
+** the following conditions:
+** The above copyright notice and this permission notice shall be included
+** in all copies or substantial portions of the Materials.
+#ifndef __eglew_h__
+#define __eglew_h__
+#define __EGLEW_H__
+#ifdef __eglext_h_
+#error eglext.h included before eglew.h
+#if defined(__egl_h_)
+#error egl.h included before eglew.h
+#define __eglext_h_
+#define __egl_h_
+#ifndef EGLAPI
+#define EGLAPI extern
+/* EGL Types */
+#include <sys/types.h>
+#include <KHR/khrplatform.h>
+#include <EGL/eglplatform.h>
+#include <GL/glew.h>
+#ifdef __cplusplus
+extern "C" {
+typedef int32_t EGLint;
+typedef unsigned int EGLBoolean;
+typedef void *EGLDisplay;
+typedef void *EGLConfig;
+typedef void *EGLSurface;
+typedef void *EGLContext;
+typedef void (*__eglMustCastToProperFunctionPointerType)(void);
+typedef unsigned int EGLenum;
+typedef void *EGLClientBuffer;
+typedef void *EGLSync;
+typedef intptr_t EGLAttrib;
+typedef khronos_utime_nanoseconds_t EGLTime;
+typedef void *EGLImage;
+typedef void *EGLSyncKHR;
+typedef intptr_t EGLAttribKHR;
+typedef void *EGLLabelKHR;
+typedef void *EGLObjectKHR;
+typedef void (EGLAPIENTRY *EGLDEBUGPROCKHR)(EGLenum error,const char *command,EGLint messageType,EGLLabelKHR threadLabel,EGLLabelKHR objectLabel,const char* message);
+typedef khronos_utime_nanoseconds_t EGLTimeKHR;
+typedef void *EGLImageKHR;
+typedef void *EGLStreamKHR;
+typedef khronos_uint64_t EGLuint64KHR;
+typedef int EGLNativeFileDescriptorKHR;
+typedef khronos_ssize_t EGLsizeiANDROID;
+typedef void (*EGLSetBlobFuncANDROID) (const void *key, EGLsizeiANDROID keySize, const void *value, EGLsizeiANDROID valueSize);
+typedef EGLsizeiANDROID (*EGLGetBlobFuncANDROID) (const void *key, EGLsizeiANDROID keySize, void *value, EGLsizeiANDROID valueSize);
+typedef void *EGLDeviceEXT;
+typedef void *EGLOutputLayerEXT;
+typedef void *EGLOutputPortEXT;
+typedef void *EGLSyncNV;
+typedef khronos_utime_nanoseconds_t EGLTimeNV;
+typedef khronos_utime_nanoseconds_t EGLuint64NV;
+typedef khronos_stime_nanoseconds_t EGLnsecsANDROID;
+struct EGLClientPixmapHI;
+#define EGL_DONT_CARE ((EGLint)-1)
+#define EGL_NO_CONTEXT ((EGLContext)0)
+#define EGL_NO_DISPLAY ((EGLDisplay)0)
+#define EGL_NO_IMAGE ((EGLImage)0)
+#define EGL_NO_SURFACE ((EGLSurface)0)
+#define EGL_NO_SYNC ((EGLSync)0)
+#define EGL_UNKNOWN ((EGLint)-1)
+#define EGL_DEFAULT_DISPLAY ((EGLNativeDisplayType)0)
+EGLAPI __eglMustCastToProperFunctionPointerType EGLAPIENTRY eglGetProcAddress (const char *procname);
+/* ---------------------------- EGL_VERSION_1_0 ---------------------------- */
+#ifndef EGL_VERSION_1_0
+#define EGL_VERSION_1_0 1
+#define EGL_FALSE 0
+#define EGL_PBUFFER_BIT 0x0001
+#define EGL_TRUE 1
+#define EGL_PIXMAP_BIT 0x0002
+#define EGL_WINDOW_BIT 0x0004
+#define EGL_SUCCESS 0x3000
+#define EGL_NOT_INITIALIZED 0x3001
+#define EGL_BAD_ACCESS 0x3002
+#define EGL_BAD_ALLOC 0x3003
+#define EGL_BAD_ATTRIBUTE 0x3004
+#define EGL_BAD_CONFIG 0x3005
+#define EGL_BAD_CONTEXT 0x3006
+#define EGL_BAD_DISPLAY 0x3008
+#define EGL_BAD_MATCH 0x3009
+#define EGL_BAD_PARAMETER 0x300C
+#define EGL_BAD_SURFACE 0x300D
+#define EGL_BUFFER_SIZE 0x3020
+#define EGL_ALPHA_SIZE 0x3021
+#define EGL_BLUE_SIZE 0x3022
+#define EGL_GREEN_SIZE 0x3023
+#define EGL_RED_SIZE 0x3024
+#define EGL_DEPTH_SIZE 0x3025
+#define EGL_STENCIL_SIZE 0x3026
+#define EGL_CONFIG_CAVEAT 0x3027
+#define EGL_CONFIG_ID 0x3028
+#define EGL_LEVEL 0x3029
+#define EGL_NATIVE_VISUAL_ID 0x302E
+#define EGL_SAMPLES 0x3031
+#define EGL_SAMPLE_BUFFERS 0x3032
+#define EGL_SURFACE_TYPE 0x3033
+#define EGL_TRANSPARENT_TYPE 0x3034
+#define EGL_NONE 0x3038
+#define EGL_SLOW_CONFIG 0x3050
+#define EGL_TRANSPARENT_RGB 0x3052
+#define EGL_VENDOR 0x3053
+#define EGL_VERSION 0x3054
+#define EGL_EXTENSIONS 0x3055
+#define EGL_HEIGHT 0x3056
+#define EGL_WIDTH 0x3057
+#define EGL_LARGEST_PBUFFER 0x3058
+#define EGL_DRAW 0x3059
+#define EGL_READ 0x305A
+typedef EGLBoolean ( * PFNEGLCHOOSECONFIGPROC) (EGLDisplay dpy, const EGLint * attrib_list, EGLConfig * configs, EGLint config_size, EGLint * num_config);
+typedef EGLBoolean ( * PFNEGLCOPYBUFFERSPROC) (EGLDisplay dpy, EGLSurface surface, EGLNativePixmapType target);
+typedef EGLContext ( * PFNEGLCREATECONTEXTPROC) (EGLDisplay dpy, EGLConfig config, EGLContext share_context, const EGLint * attrib_list);
+typedef EGLSurface ( * PFNEGLCREATEPBUFFERSURFACEPROC) (EGLDisplay dpy, EGLConfig config, const EGLint * attrib_list);
+typedef EGLSurface ( * PFNEGLCREATEPIXMAPSURFACEPROC) (EGLDisplay dpy, EGLConfig config, EGLNativePixmapType pixmap, const EGLint * attrib_list);
+typedef EGLSurface ( * PFNEGLCREATEWINDOWSURFACEPROC) (EGLDisplay dpy, EGLConfig config, EGLNativeWindowType win, const EGLint * attrib_list);
+typedef EGLBoolean ( * PFNEGLDESTROYCONTEXTPROC) (EGLDisplay dpy, EGLContext ctx);
+typedef EGLBoolean ( * PFNEGLDESTROYSURFACEPROC) (EGLDisplay dpy, EGLSurface surface);
+typedef EGLBoolean ( * PFNEGLGETCONFIGATTRIBPROC) (EGLDisplay dpy, EGLConfig config, EGLint attribute, EGLint * value);
+typedef EGLBoolean ( * PFNEGLGETCONFIGSPROC) (EGLDisplay dpy, EGLConfig * configs, EGLint config_size, EGLint * num_config);
+typedef EGLDisplay ( * PFNEGLGETCURRENTDISPLAYPROC) ( void );
+typedef EGLSurface ( * PFNEGLGETCURRENTSURFACEPROC) (EGLint readdraw);
+typedef EGLDisplay ( * PFNEGLGETDISPLAYPROC) (EGLNativeDisplayType display_id);
+typedef EGLint ( * PFNEGLGETERRORPROC) ( void );
+typedef EGLBoolean ( * PFNEGLINITIALIZEPROC) (EGLDisplay dpy, EGLint * major, EGLint * minor);
+typedef EGLBoolean ( * PFNEGLMAKECURRENTPROC) (EGLDisplay dpy, EGLSurface draw, EGLSurface read, EGLContext ctx);
+typedef EGLBoolean ( * PFNEGLQUERYCONTEXTPROC) (EGLDisplay dpy, EGLContext ctx, EGLint attribute, EGLint * value);
+typedef const char * ( * PFNEGLQUERYSTRINGPROC) (EGLDisplay dpy, EGLint name);
+typedef EGLBoolean ( * PFNEGLQUERYSURFACEPROC) (EGLDisplay dpy, EGLSurface surface, EGLint attribute, EGLint * value);
+typedef EGLBoolean ( * PFNEGLSWAPBUFFERSPROC) (EGLDisplay dpy, EGLSurface surface);
+typedef EGLBoolean ( * PFNEGLTERMINATEPROC) (EGLDisplay dpy);
+typedef EGLBoolean ( * PFNEGLWAITGLPROC) ( void );
+typedef EGLBoolean ( * PFNEGLWAITNATIVEPROC) (EGLint engine);
+#define eglChooseConfig EGLEW_GET_FUN(__eglewChooseConfig)
+#define eglCopyBuffers EGLEW_GET_FUN(__eglewCopyBuffers)
+#define eglCreateContext EGLEW_GET_FUN(__eglewCreateContext)
+#define eglCreatePbufferSurface EGLEW_GET_FUN(__eglewCreatePbufferSurface)
+#define eglCreatePixmapSurface EGLEW_GET_FUN(__eglewCreatePixmapSurface)
+#define eglCreateWindowSurface EGLEW_GET_FUN(__eglewCreateWindowSurface)
+#define eglDestroyContext EGLEW_GET_FUN(__eglewDestroyContext)
+#define eglDestroySurface EGLEW_GET_FUN(__eglewDestroySurface)
+#define eglGetConfigAttrib EGLEW_GET_FUN(__eglewGetConfigAttrib)
+#define eglGetConfigs EGLEW_GET_FUN(__eglewGetConfigs)
+#define eglGetCurrentDisplay EGLEW_GET_FUN(__eglewGetCurrentDisplay)
+#define eglGetCurrentSurface EGLEW_GET_FUN(__eglewGetCurrentSurface)
+#define eglGetDisplay EGLEW_GET_FUN(__eglewGetDisplay)
+#define eglGetError EGLEW_GET_FUN(__eglewGetError)
+#define eglInitialize EGLEW_GET_FUN(__eglewInitialize)
+#define eglMakeCurrent EGLEW_GET_FUN(__eglewMakeCurrent)
+#define eglQueryContext EGLEW_GET_FUN(__eglewQueryContext)
+#define eglQueryString EGLEW_GET_FUN(__eglewQueryString)
+#define eglQuerySurface EGLEW_GET_FUN(__eglewQuerySurface)
+#define eglSwapBuffers EGLEW_GET_FUN(__eglewSwapBuffers)
+#define eglTerminate EGLEW_GET_FUN(__eglewTerminate)
+#define eglWaitGL EGLEW_GET_FUN(__eglewWaitGL)
+#define eglWaitNative EGLEW_GET_FUN(__eglewWaitNative)
+#endif /* EGL_VERSION_1_0 */
+/* ---------------------------- EGL_VERSION_1_1 ---------------------------- */
+#ifndef EGL_VERSION_1_1
+#define EGL_VERSION_1_1 1
+#define EGL_CONTEXT_LOST 0x300E
+#define EGL_BIND_TO_TEXTURE_RGB 0x3039
+#define EGL_NO_TEXTURE 0x305C
+#define EGL_TEXTURE_RGB 0x305D
+#define EGL_TEXTURE_RGBA 0x305E
+#define EGL_TEXTURE_2D 0x305F
+#define EGL_TEXTURE_FORMAT 0x3080
+#define EGL_TEXTURE_TARGET 0x3081
+#define EGL_MIPMAP_TEXTURE 0x3082
+#define EGL_MIPMAP_LEVEL 0x3083
+#define EGL_BACK_BUFFER 0x3084
+typedef EGLBoolean ( * PFNEGLBINDTEXIMAGEPROC) (EGLDisplay dpy, EGLSurface surface, EGLint buffer);
+typedef EGLBoolean ( * PFNEGLRELEASETEXIMAGEPROC) (EGLDisplay dpy, EGLSurface surface, EGLint buffer);
+typedef EGLBoolean ( * PFNEGLSURFACEATTRIBPROC) (EGLDisplay dpy, EGLSurface surface, EGLint attribute, EGLint value);
+typedef EGLBoolean ( * PFNEGLSWAPINTERVALPROC) (EGLDisplay dpy, EGLint interval);
+#define eglBindTexImage EGLEW_GET_FUN(__eglewBindTexImage)
+#define eglReleaseTexImage EGLEW_GET_FUN(__eglewReleaseTexImage)
+#define eglSurfaceAttrib EGLEW_GET_FUN(__eglewSurfaceAttrib)
+#define eglSwapInterval EGLEW_GET_FUN(__eglewSwapInterval)
+#endif /* EGL_VERSION_1_1 */
+/* ---------------------------- EGL_VERSION_1_2 ---------------------------- */
+#ifndef EGL_VERSION_1_2
+#define EGL_VERSION_1_2 1
+#define EGL_OPENGL_ES_BIT 0x0001
+#define EGL_OPENVG_BIT 0x0002
+#define EGL_LUMINANCE_SIZE 0x303D
+#define EGL_ALPHA_MASK_SIZE 0x303E
+#define EGL_RENDERABLE_TYPE 0x3040
+#define EGL_SINGLE_BUFFER 0x3085
+#define EGL_RENDER_BUFFER 0x3086
+#define EGL_COLORSPACE 0x3087
+#define EGL_ALPHA_FORMAT 0x3088
+#define EGL_ALPHA_FORMAT_PRE 0x308C
+#define EGL_CLIENT_APIS 0x308D
+#define EGL_RGB_BUFFER 0x308E
+#define EGL_PIXEL_ASPECT_RATIO 0x3092
+#define EGL_SWAP_BEHAVIOR 0x3093
+#define EGL_BUFFER_PRESERVED 0x3094
+#define EGL_BUFFER_DESTROYED 0x3095
+#define EGL_OPENVG_IMAGE 0x3096
+#define EGL_OPENGL_ES_API 0x30A0
+#define EGL_OPENVG_API 0x30A1
+#define EGL_DISPLAY_SCALING 10000
+typedef EGLBoolean ( * PFNEGLBINDAPIPROC) (EGLenum api);
+typedef EGLSurface ( * PFNEGLCREATEPBUFFERFROMCLIENTBUFFERPROC) (EGLDisplay dpy, EGLenum buftype, EGLClientBuffer buffer, EGLConfig config, const EGLint * attrib_list);
+typedef EGLenum ( * PFNEGLQUERYAPIPROC) ( void );
+typedef EGLBoolean ( * PFNEGLRELEASETHREADPROC) ( void );
+typedef EGLBoolean ( * PFNEGLWAITCLIENTPROC) ( void );
+#define eglBindAPI EGLEW_GET_FUN(__eglewBindAPI)
+#define eglCreatePbufferFromClientBuffer EGLEW_GET_FUN(__eglewCreatePbufferFromClientBuffer)
+#define eglQueryAPI EGLEW_GET_FUN(__eglewQueryAPI)
+#define eglReleaseThread EGLEW_GET_FUN(__eglewReleaseThread)
+#define eglWaitClient EGLEW_GET_FUN(__eglewWaitClient)
+#endif /* EGL_VERSION_1_2 */
+/* ---------------------------- EGL_VERSION_1_3 ---------------------------- */
+#ifndef EGL_VERSION_1_3
+#define EGL_VERSION_1_3 1
+#define EGL_OPENGL_ES2_BIT 0x0004
+#define EGL_CONFORMANT 0x3042
+#define EGL_VG_COLORSPACE 0x3087
+#define EGL_VG_ALPHA_FORMAT 0x3088
+#endif /* EGL_VERSION_1_3 */
+/* ---------------------------- EGL_VERSION_1_4 ---------------------------- */
+#ifndef EGL_VERSION_1_4
+#define EGL_VERSION_1_4 1
+#define EGL_OPENGL_BIT 0x0008
+#define EGL_OPENGL_API 0x30A2
+typedef EGLContext ( * PFNEGLGETCURRENTCONTEXTPROC) ( void );
+#define eglGetCurrentContext EGLEW_GET_FUN(__eglewGetCurrentContext)
+#endif /* EGL_VERSION_1_4 */
+/* ---------------------------- EGL_VERSION_1_5 ---------------------------- */
+#ifndef EGL_VERSION_1_5
+#define EGL_VERSION_1_5 1
+#define EGL_OPENGL_ES3_BIT 0x00000040
+#define EGL_GL_COLORSPACE_SRGB 0x3089
+#define EGL_CL_EVENT_HANDLE 0x309C
+#define EGL_GL_COLORSPACE 0x309D
+#define EGL_GL_TEXTURE_2D 0x30B1
+#define EGL_GL_TEXTURE_3D 0x30B2
+#define EGL_SYNC_STATUS 0x30F1
+#define EGL_SIGNALED 0x30F2
+#define EGL_UNSIGNALED 0x30F3
+#define EGL_SYNC_TYPE 0x30F7
+#define EGL_SYNC_CONDITION 0x30F8
+#define EGL_SYNC_FENCE 0x30F9
+#define EGL_SYNC_CL_EVENT 0x30FE
+typedef EGLint ( * PFNEGLCLIENTWAITSYNCPROC) (EGLDisplay dpy, EGLSync sync, EGLint flags, EGLTime timeout);
+typedef EGLImage ( * PFNEGLCREATEIMAGEPROC) (EGLDisplay dpy, EGLContext ctx, EGLenum target, EGLClientBuffer buffer, const EGLAttrib * attrib_list);
+typedef EGLSurface ( * PFNEGLCREATEPLATFORMPIXMAPSURFACEPROC) (EGLDisplay dpy, EGLConfig config, void * native_pixmap, const EGLAttrib * attrib_list);
+typedef EGLSurface ( * PFNEGLCREATEPLATFORMWINDOWSURFACEPROC) (EGLDisplay dpy, EGLConfig config, void * native_window, const EGLAttrib * attrib_list);
+typedef EGLSync ( * PFNEGLCREATESYNCPROC) (EGLDisplay dpy, EGLenum type, const EGLAttrib * attrib_list);
+typedef EGLBoolean ( * PFNEGLDESTROYIMAGEPROC) (EGLDisplay dpy, EGLImage image);
+typedef EGLBoolean ( * PFNEGLDESTROYSYNCPROC) (EGLDisplay dpy, EGLSync sync);
+typedef EGLDisplay ( * PFNEGLGETPLATFORMDISPLAYPROC) (EGLenum platform, void * native_display, const EGLAttrib * attrib_list);
+typedef EGLBoolean ( * PFNEGLGETSYNCATTRIBPROC) (EGLDisplay dpy, EGLSync sync, EGLint attribute, EGLAttrib * value);
+typedef EGLBoolean ( * PFNEGLWAITSYNCPROC) (EGLDisplay dpy, EGLSync sync, EGLint flags);
+#define eglClientWaitSync EGLEW_GET_FUN(__eglewClientWaitSync)
+#define eglCreateImage EGLEW_GET_FUN(__eglewCreateImage)
+#define eglCreatePlatformPixmapSurface EGLEW_GET_FUN(__eglewCreatePlatformPixmapSurface)
+#define eglCreatePlatformWindowSurface EGLEW_GET_FUN(__eglewCreatePlatformWindowSurface)
+#define eglCreateSync EGLEW_GET_FUN(__eglewCreateSync)
+#define eglDestroyImage EGLEW_GET_FUN(__eglewDestroyImage)
+#define eglDestroySync EGLEW_GET_FUN(__eglewDestroySync)
+#define eglGetPlatformDisplay EGLEW_GET_FUN(__eglewGetPlatformDisplay)
+#define eglGetSyncAttrib EGLEW_GET_FUN(__eglewGetSyncAttrib)
+#define eglWaitSync EGLEW_GET_FUN(__eglewWaitSync)
+#endif /* EGL_VERSION_1_5 */
+/* ------------------------- EGL_ANDROID_blob_cache ------------------------ */
+#ifndef EGL_ANDROID_blob_cache
+#define EGL_ANDROID_blob_cache 1
+#define eglSetBlobCacheFuncsANDROID EGLEW_GET_FUN(__eglewSetBlobCacheFuncsANDROID)
+#define EGLEW_ANDROID_blob_cache EGLEW_GET_VAR(__EGLEW_ANDROID_blob_cache)
+#endif /* EGL_ANDROID_blob_cache */
+/* ---------------- EGL_ANDROID_create_native_client_buffer ---------------- */
+#ifndef EGL_ANDROID_create_native_client_buffer
+#define EGL_ANDROID_create_native_client_buffer 1
+typedef EGLClientBuffer ( * PFNEGLCREATENATIVECLIENTBUFFERANDROIDPROC) (const EGLint * attrib_list);
+#define eglCreateNativeClientBufferANDROID EGLEW_GET_FUN(__eglewCreateNativeClientBufferANDROID)
+#define EGLEW_ANDROID_create_native_client_buffer EGLEW_GET_VAR(__EGLEW_ANDROID_create_native_client_buffer)
+#endif /* EGL_ANDROID_create_native_client_buffer */
+/* --------------------- EGL_ANDROID_framebuffer_target -------------------- */
+#ifndef EGL_ANDROID_framebuffer_target
+#define EGL_ANDROID_framebuffer_target 1
+#define EGLEW_ANDROID_framebuffer_target EGLEW_GET_VAR(__EGLEW_ANDROID_framebuffer_target)
+#endif /* EGL_ANDROID_framebuffer_target */
+/* ----------------- EGL_ANDROID_front_buffer_auto_refresh ----------------- */
+#ifndef EGL_ANDROID_front_buffer_auto_refresh
+#define EGL_ANDROID_front_buffer_auto_refresh 1
+#define EGLEW_ANDROID_front_buffer_auto_refresh EGLEW_GET_VAR(__EGLEW_ANDROID_front_buffer_auto_refresh)
+#endif /* EGL_ANDROID_front_buffer_auto_refresh */
+/* -------------------- EGL_ANDROID_image_native_buffer -------------------- */
+#ifndef EGL_ANDROID_image_native_buffer
+#define EGL_ANDROID_image_native_buffer 1
+#define EGLEW_ANDROID_image_native_buffer EGLEW_GET_VAR(__EGLEW_ANDROID_image_native_buffer)
+#endif /* EGL_ANDROID_image_native_buffer */
+/* --------------------- EGL_ANDROID_native_fence_sync --------------------- */
+#ifndef EGL_ANDROID_native_fence_sync
+#define EGL_ANDROID_native_fence_sync 1
+#define eglDupNativeFenceFDANDROID EGLEW_GET_FUN(__eglewDupNativeFenceFDANDROID)
+#define EGLEW_ANDROID_native_fence_sync EGLEW_GET_VAR(__EGLEW_ANDROID_native_fence_sync)
+#endif /* EGL_ANDROID_native_fence_sync */
+/* --------------------- EGL_ANDROID_presentation_time --------------------- */
+#ifndef EGL_ANDROID_presentation_time
+#define EGL_ANDROID_presentation_time 1
+typedef EGLBoolean ( * PFNEGLPRESENTATIONTIMEANDROIDPROC) (EGLDisplay dpy, EGLSurface surface, EGLnsecsANDROID time);
+#define eglPresentationTimeANDROID EGLEW_GET_FUN(__eglewPresentationTimeANDROID)
+#define EGLEW_ANDROID_presentation_time EGLEW_GET_VAR(__EGLEW_ANDROID_presentation_time)
+#endif /* EGL_ANDROID_presentation_time */
+/* ------------------------- EGL_ANDROID_recordable ------------------------ */
+#ifndef EGL_ANDROID_recordable
+#define EGL_ANDROID_recordable 1
+#define EGLEW_ANDROID_recordable EGLEW_GET_VAR(__EGLEW_ANDROID_recordable)
+#endif /* EGL_ANDROID_recordable */
+/* ---------------- EGL_ANGLE_d3d_share_handle_client_buffer --------------- */
+#ifndef EGL_ANGLE_d3d_share_handle_client_buffer
+#define EGL_ANGLE_d3d_share_handle_client_buffer 1
+#define EGLEW_ANGLE_d3d_share_handle_client_buffer EGLEW_GET_VAR(__EGLEW_ANGLE_d3d_share_handle_client_buffer)
+#endif /* EGL_ANGLE_d3d_share_handle_client_buffer */
+/* -------------------------- EGL_ANGLE_device_d3d ------------------------- */
+#ifndef EGL_ANGLE_device_d3d
+#define EGL_ANGLE_device_d3d 1
+#define EGL_D3D9_DEVICE_ANGLE 0x33A0
+#define EGL_D3D11_DEVICE_ANGLE 0x33A1
+#define EGLEW_ANGLE_device_d3d EGLEW_GET_VAR(__EGLEW_ANGLE_device_d3d)
+#endif /* EGL_ANGLE_device_d3d */
+/* -------------------- EGL_ANGLE_query_surface_pointer -------------------- */
+#ifndef EGL_ANGLE_query_surface_pointer
+#define EGL_ANGLE_query_surface_pointer 1
+typedef EGLBoolean ( * PFNEGLQUERYSURFACEPOINTERANGLEPROC) (EGLDisplay dpy, EGLSurface surface, EGLint attribute, void ** value);
+#define eglQuerySurfacePointerANGLE EGLEW_GET_FUN(__eglewQuerySurfacePointerANGLE)
+#define EGLEW_ANGLE_query_surface_pointer EGLEW_GET_VAR(__EGLEW_ANGLE_query_surface_pointer)
+#endif /* EGL_ANGLE_query_surface_pointer */
+/* ------------- EGL_ANGLE_surface_d3d_texture_2d_share_handle ------------- */
+#ifndef EGL_ANGLE_surface_d3d_texture_2d_share_handle
+#define EGL_ANGLE_surface_d3d_texture_2d_share_handle 1
+#define EGLEW_ANGLE_surface_d3d_texture_2d_share_handle EGLEW_GET_VAR(__EGLEW_ANGLE_surface_d3d_texture_2d_share_handle)
+#endif /* EGL_ANGLE_surface_d3d_texture_2d_share_handle */
+/* ---------------------- EGL_ANGLE_window_fixed_size ---------------------- */
+#ifndef EGL_ANGLE_window_fixed_size
+#define EGL_ANGLE_window_fixed_size 1
+#define EGL_FIXED_SIZE_ANGLE 0x3201
+#define EGLEW_ANGLE_window_fixed_size EGLEW_GET_VAR(__EGLEW_ANGLE_window_fixed_size)
+#endif /* EGL_ANGLE_window_fixed_size */
+/* --------------------- EGL_ARM_implicit_external_sync -------------------- */
+#ifndef EGL_ARM_implicit_external_sync
+#define EGL_ARM_implicit_external_sync 1
+#define EGLEW_ARM_implicit_external_sync EGLEW_GET_VAR(__EGLEW_ARM_implicit_external_sync)
+#endif /* EGL_ARM_implicit_external_sync */
+/* ------------------- EGL_ARM_pixmap_multisample_discard ------------------ */
+#ifndef EGL_ARM_pixmap_multisample_discard
+#define EGL_ARM_pixmap_multisample_discard 1
+#define EGLEW_ARM_pixmap_multisample_discard EGLEW_GET_VAR(__EGLEW_ARM_pixmap_multisample_discard)
+#endif /* EGL_ARM_pixmap_multisample_discard */
+/* --------------------------- EGL_EXT_buffer_age -------------------------- */
+#ifndef EGL_EXT_buffer_age
+#define EGL_EXT_buffer_age 1
+#define EGL_BUFFER_AGE_EXT 0x313D
+#define EGLEW_EXT_buffer_age EGLEW_GET_VAR(__EGLEW_EXT_buffer_age)
+#endif /* EGL_EXT_buffer_age */
+/* ----------------------- EGL_EXT_client_extensions ----------------------- */
+#ifndef EGL_EXT_client_extensions
+#define EGL_EXT_client_extensions 1
+#define EGLEW_EXT_client_extensions EGLEW_GET_VAR(__EGLEW_EXT_client_extensions)
+#endif /* EGL_EXT_client_extensions */
+/* ------------------- EGL_EXT_create_context_robustness ------------------- */
+#ifndef EGL_EXT_create_context_robustness
+#define EGL_EXT_create_context_robustness 1
+#define EGLEW_EXT_create_context_robustness EGLEW_GET_VAR(__EGLEW_EXT_create_context_robustness)
+#endif /* EGL_EXT_create_context_robustness */
+/* -------------------------- EGL_EXT_device_base -------------------------- */
+#ifndef EGL_EXT_device_base
+#define EGL_EXT_device_base 1
+#define EGL_BAD_DEVICE_EXT 0x322B
+#define EGL_DEVICE_EXT 0x322C
+#define EGLEW_EXT_device_base EGLEW_GET_VAR(__EGLEW_EXT_device_base)
+#endif /* EGL_EXT_device_base */
+/* --------------------------- EGL_EXT_device_drm -------------------------- */
+#ifndef EGL_EXT_device_drm
+#define EGL_EXT_device_drm 1
+#define EGL_DRM_DEVICE_FILE_EXT 0x3233
+#define EGLEW_EXT_device_drm EGLEW_GET_VAR(__EGLEW_EXT_device_drm)
+#endif /* EGL_EXT_device_drm */
+/* ----------------------- EGL_EXT_device_enumeration ---------------------- */
+#ifndef EGL_EXT_device_enumeration
+#define EGL_EXT_device_enumeration 1
+typedef EGLBoolean ( * PFNEGLQUERYDEVICESEXTPROC) (EGLint max_devices, EGLDeviceEXT * devices, EGLint * num_devices);
+#define eglQueryDevicesEXT EGLEW_GET_FUN(__eglewQueryDevicesEXT)
+#define EGLEW_EXT_device_enumeration EGLEW_GET_VAR(__EGLEW_EXT_device_enumeration)
+#endif /* EGL_EXT_device_enumeration */
+/* ------------------------- EGL_EXT_device_openwf ------------------------- */
+#ifndef EGL_EXT_device_openwf
+#define EGL_EXT_device_openwf 1
+#define EGL_OPENWF_DEVICE_ID_EXT 0x3237
+#define EGLEW_EXT_device_openwf EGLEW_GET_VAR(__EGLEW_EXT_device_openwf)
+#endif /* EGL_EXT_device_openwf */
+/* -------------------------- EGL_EXT_device_query ------------------------- */
+#ifndef EGL_EXT_device_query
+#define EGL_EXT_device_query 1
+#define EGL_BAD_DEVICE_EXT 0x322B
+#define EGL_DEVICE_EXT 0x322C
+typedef EGLBoolean ( * PFNEGLQUERYDEVICEATTRIBEXTPROC) (EGLDeviceEXT device, EGLint attribute, EGLAttrib * value);
+typedef const char * ( * PFNEGLQUERYDEVICESTRINGEXTPROC) (EGLDeviceEXT device, EGLint name);
+typedef EGLBoolean ( * PFNEGLQUERYDISPLAYATTRIBEXTPROC) (EGLDisplay dpy, EGLint attribute, EGLAttrib * value);
+#define eglQueryDeviceAttribEXT EGLEW_GET_FUN(__eglewQueryDeviceAttribEXT)
+#define eglQueryDeviceStringEXT EGLEW_GET_FUN(__eglewQueryDeviceStringEXT)
+#define eglQueryDisplayAttribEXT EGLEW_GET_FUN(__eglewQueryDisplayAttribEXT)
+#define EGLEW_EXT_device_query EGLEW_GET_VAR(__EGLEW_EXT_device_query)
+#endif /* EGL_EXT_device_query */
+/* ------------------ EGL_EXT_gl_colorspace_bt2020_linear ------------------ */
+#ifndef EGL_EXT_gl_colorspace_bt2020_linear
+#define EGL_EXT_gl_colorspace_bt2020_linear 1
+#define EGLEW_EXT_gl_colorspace_bt2020_linear EGLEW_GET_VAR(__EGLEW_EXT_gl_colorspace_bt2020_linear)
+#endif /* EGL_EXT_gl_colorspace_bt2020_linear */
+/* -------------------- EGL_EXT_gl_colorspace_bt2020_pq -------------------- */
+#ifndef EGL_EXT_gl_colorspace_bt2020_pq
+#define EGL_EXT_gl_colorspace_bt2020_pq 1
+#define EGL_GL_COLORSPACE_BT2020_PQ_EXT 0x3340
+#define EGLEW_EXT_gl_colorspace_bt2020_pq EGLEW_GET_VAR(__EGLEW_EXT_gl_colorspace_bt2020_pq)
+#endif /* EGL_EXT_gl_colorspace_bt2020_pq */
+/* ------------------- EGL_EXT_gl_colorspace_scrgb_linear ------------------ */
+#ifndef EGL_EXT_gl_colorspace_scrgb_linear
+#define EGL_EXT_gl_colorspace_scrgb_linear 1
+#define EGLEW_EXT_gl_colorspace_scrgb_linear EGLEW_GET_VAR(__EGLEW_EXT_gl_colorspace_scrgb_linear)
+#endif /* EGL_EXT_gl_colorspace_scrgb_linear */
+/* ---------------------- EGL_EXT_image_dma_buf_import --------------------- */
+#ifndef EGL_EXT_image_dma_buf_import
+#define EGL_EXT_image_dma_buf_import 1
+#define EGL_LINUX_DMA_BUF_EXT 0x3270
+#define EGL_LINUX_DRM_FOURCC_EXT 0x3271
+#define EGL_DMA_BUF_PLANE0_FD_EXT 0x3272
+#define EGL_DMA_BUF_PLANE0_PITCH_EXT 0x3274
+#define EGL_DMA_BUF_PLANE1_FD_EXT 0x3275
+#define EGL_DMA_BUF_PLANE1_PITCH_EXT 0x3277
+#define EGL_DMA_BUF_PLANE2_FD_EXT 0x3278
+#define EGL_ITU_REC601_EXT 0x327F
+#define EGL_ITU_REC709_EXT 0x3280
+#define EGL_ITU_REC2020_EXT 0x3281
+#define EGL_YUV_FULL_RANGE_EXT 0x3282
+#define EGL_YUV_NARROW_RANGE_EXT 0x3283
+#define EGL_YUV_CHROMA_SITING_0_EXT 0x3284
+#define EGL_YUV_CHROMA_SITING_0_5_EXT 0x3285
+#define EGLEW_EXT_image_dma_buf_import EGLEW_GET_VAR(__EGLEW_EXT_image_dma_buf_import)
+#endif /* EGL_EXT_image_dma_buf_import */
+/* ----------------- EGL_EXT_image_dma_buf_import_modifiers ---------------- */
+#ifndef EGL_EXT_image_dma_buf_import_modifiers
+#define EGL_EXT_image_dma_buf_import_modifiers 1
+#define EGL_DMA_BUF_PLANE3_FD_EXT 0x3440
+#define EGL_DMA_BUF_PLANE3_PITCH_EXT 0x3442
+typedef EGLBoolean ( * PFNEGLQUERYDMABUFFORMATSEXTPROC) (EGLDisplay dpy, EGLint max_formats, EGLint *formats, EGLint *num_formats);
+typedef EGLBoolean ( * PFNEGLQUERYDMABUFMODIFIERSEXTPROC) (EGLDisplay dpy, EGLint format, EGLint max_modifiers, EGLuint64KHR *modifiers, EGLBoolean *external_only, EGLint *num_modifiers);
+#define eglQueryDmaBufFormatsEXT EGLEW_GET_FUN(__eglewQueryDmaBufFormatsEXT)
+#define eglQueryDmaBufModifiersEXT EGLEW_GET_FUN(__eglewQueryDmaBufModifiersEXT)
+#define EGLEW_EXT_image_dma_buf_import_modifiers EGLEW_GET_VAR(__EGLEW_EXT_image_dma_buf_import_modifiers)
+#endif /* EGL_EXT_image_dma_buf_import_modifiers */
+/* ------------------------ EGL_EXT_multiview_window ----------------------- */
+#ifndef EGL_EXT_multiview_window
+#define EGL_EXT_multiview_window 1
+#define EGLEW_EXT_multiview_window EGLEW_GET_VAR(__EGLEW_EXT_multiview_window)
+#endif /* EGL_EXT_multiview_window */
+/* -------------------------- EGL_EXT_output_base -------------------------- */
+#ifndef EGL_EXT_output_base
+#define EGL_EXT_output_base 1
+typedef EGLBoolean ( * PFNEGLGETOUTPUTLAYERSEXTPROC) (EGLDisplay dpy, const EGLAttrib * attrib_list, EGLOutputLayerEXT * layers, EGLint max_layers, EGLint * num_layers);
+typedef EGLBoolean ( * PFNEGLGETOUTPUTPORTSEXTPROC) (EGLDisplay dpy, const EGLAttrib * attrib_list, EGLOutputPortEXT * ports, EGLint max_ports, EGLint * num_ports);
+typedef EGLBoolean ( * PFNEGLOUTPUTLAYERATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint attribute, EGLAttrib value);
+typedef EGLBoolean ( * PFNEGLOUTPUTPORTATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputPortEXT port, EGLint attribute, EGLAttrib value);
+typedef EGLBoolean ( * PFNEGLQUERYOUTPUTLAYERATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint attribute, EGLAttrib * value);
+typedef const char * ( * PFNEGLQUERYOUTPUTLAYERSTRINGEXTPROC) (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint name);
+typedef EGLBoolean ( * PFNEGLQUERYOUTPUTPORTATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputPortEXT port, EGLint attribute, EGLAttrib * value);
+typedef const char * ( * PFNEGLQUERYOUTPUTPORTSTRINGEXTPROC) (EGLDisplay dpy, EGLOutputPortEXT port, EGLint name);
+#define eglGetOutputLayersEXT EGLEW_GET_FUN(__eglewGetOutputLayersEXT)
+#define eglGetOutputPortsEXT EGLEW_GET_FUN(__eglewGetOutputPortsEXT)
+#define eglOutputLayerAttribEXT EGLEW_GET_FUN(__eglewOutputLayerAttribEXT)
+#define eglOutputPortAttribEXT EGLEW_GET_FUN(__eglewOutputPortAttribEXT)
+#define eglQueryOutputLayerAttribEXT EGLEW_GET_FUN(__eglewQueryOutputLayerAttribEXT)
+#define eglQueryOutputLayerStringEXT EGLEW_GET_FUN(__eglewQueryOutputLayerStringEXT)
+#define eglQueryOutputPortAttribEXT EGLEW_GET_FUN(__eglewQueryOutputPortAttribEXT)
+#define eglQueryOutputPortStringEXT EGLEW_GET_FUN(__eglewQueryOutputPortStringEXT)
+#define EGLEW_EXT_output_base EGLEW_GET_VAR(__EGLEW_EXT_output_base)
+#endif /* EGL_EXT_output_base */
+/* --------------------------- EGL_EXT_output_drm -------------------------- */
+#ifndef EGL_EXT_output_drm
+#define EGL_EXT_output_drm 1
+#define EGL_DRM_CRTC_EXT 0x3234
+#define EGL_DRM_PLANE_EXT 0x3235
+#define EGL_DRM_CONNECTOR_EXT 0x3236
+#define EGLEW_EXT_output_drm EGLEW_GET_VAR(__EGLEW_EXT_output_drm)
+#endif /* EGL_EXT_output_drm */
+/* ------------------------- EGL_EXT_output_openwf ------------------------- */
+#ifndef EGL_EXT_output_openwf
+#define EGL_EXT_output_openwf 1
+#define EGL_OPENWF_PORT_ID_EXT 0x3239
+#define EGLEW_EXT_output_openwf EGLEW_GET_VAR(__EGLEW_EXT_output_openwf)
+#endif /* EGL_EXT_output_openwf */
+/* ----------------------- EGL_EXT_pixel_format_float ---------------------- */
+#ifndef EGL_EXT_pixel_format_float
+#define EGL_EXT_pixel_format_float 1
+#define EGLEW_EXT_pixel_format_float EGLEW_GET_VAR(__EGLEW_EXT_pixel_format_float)
+#endif /* EGL_EXT_pixel_format_float */
+/* ------------------------- EGL_EXT_platform_base ------------------------- */
+#ifndef EGL_EXT_platform_base
+#define EGL_EXT_platform_base 1
+typedef EGLSurface ( * PFNEGLCREATEPLATFORMPIXMAPSURFACEEXTPROC) (EGLDisplay dpy, EGLConfig config, void * native_pixmap, const EGLint * attrib_list);
+typedef EGLSurface ( * PFNEGLCREATEPLATFORMWINDOWSURFACEEXTPROC) (EGLDisplay dpy, EGLConfig config, void * native_window, const EGLint * attrib_list);
+typedef EGLDisplay ( * PFNEGLGETPLATFORMDISPLAYEXTPROC) (EGLenum platform, void * native_display, const EGLint * attrib_list);
+#define eglCreatePlatformPixmapSurfaceEXT EGLEW_GET_FUN(__eglewCreatePlatformPixmapSurfaceEXT)
+#define eglCreatePlatformWindowSurfaceEXT EGLEW_GET_FUN(__eglewCreatePlatformWindowSurfaceEXT)
+#define eglGetPlatformDisplayEXT EGLEW_GET_FUN(__eglewGetPlatformDisplayEXT)
+#define EGLEW_EXT_platform_base EGLEW_GET_VAR(__EGLEW_EXT_platform_base)
+#endif /* EGL_EXT_platform_base */
+/* ------------------------ EGL_EXT_platform_device ------------------------ */
+#ifndef EGL_EXT_platform_device
+#define EGL_EXT_platform_device 1
+#define EGLEW_EXT_platform_device EGLEW_GET_VAR(__EGLEW_EXT_platform_device)
+#endif /* EGL_EXT_platform_device */
+/* ------------------------ EGL_EXT_platform_wayland ----------------------- */
+#ifndef EGL_EXT_platform_wayland
+#define EGL_EXT_platform_wayland 1
+#define EGLEW_EXT_platform_wayland EGLEW_GET_VAR(__EGLEW_EXT_platform_wayland)
+#endif /* EGL_EXT_platform_wayland */
+/* -------------------------- EGL_EXT_platform_x11 ------------------------- */
+#ifndef EGL_EXT_platform_x11
+#define EGL_EXT_platform_x11 1
+#define EGL_PLATFORM_X11_EXT 0x31D5
+#define EGLEW_EXT_platform_x11 EGLEW_GET_VAR(__EGLEW_EXT_platform_x11)
+#endif /* EGL_EXT_platform_x11 */
+/* ----------------------- EGL_EXT_protected_content ----------------------- */
+#ifndef EGL_EXT_protected_content
+#define EGL_EXT_protected_content 1
+#define EGLEW_EXT_protected_content EGLEW_GET_VAR(__EGLEW_EXT_protected_content)
+#endif /* EGL_EXT_protected_content */
+/* ----------------------- EGL_EXT_protected_surface ----------------------- */
+#ifndef EGL_EXT_protected_surface
+#define EGL_EXT_protected_surface 1
+#define EGLEW_EXT_protected_surface EGLEW_GET_VAR(__EGLEW_EXT_protected_surface)
+#endif /* EGL_EXT_protected_surface */
+/* ------------------- EGL_EXT_stream_consumer_egloutput ------------------- */
+#ifndef EGL_EXT_stream_consumer_egloutput
+#define EGL_EXT_stream_consumer_egloutput 1
+typedef EGLBoolean ( * PFNEGLSTREAMCONSUMEROUTPUTEXTPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLOutputLayerEXT layer);
+#define eglStreamConsumerOutputEXT EGLEW_GET_FUN(__eglewStreamConsumerOutputEXT)
+#define EGLEW_EXT_stream_consumer_egloutput EGLEW_GET_VAR(__EGLEW_EXT_stream_consumer_egloutput)
+#endif /* EGL_EXT_stream_consumer_egloutput */
+/* ------------------- EGL_EXT_surface_SMPTE2086_metadata ------------------ */
+#ifndef EGL_EXT_surface_SMPTE2086_metadata
+#define EGL_EXT_surface_SMPTE2086_metadata 1
+#define EGL_SMPTE2086_WHITE_POINT_X_EXT 0x3347
+#define EGL_SMPTE2086_WHITE_POINT_Y_EXT 0x3348
+#define EGL_SMPTE2086_MAX_LUMINANCE_EXT 0x3349
+#define EGLEW_EXT_surface_SMPTE2086_metadata EGLEW_GET_VAR(__EGLEW_EXT_surface_SMPTE2086_metadata)
+#endif /* EGL_EXT_surface_SMPTE2086_metadata */
+/* -------------------- EGL_EXT_swap_buffers_with_damage ------------------- */
+#ifndef EGL_EXT_swap_buffers_with_damage
+#define EGL_EXT_swap_buffers_with_damage 1
+typedef EGLBoolean ( * PFNEGLSWAPBUFFERSWITHDAMAGEEXTPROC) (EGLDisplay dpy, EGLSurface surface, EGLint * rects, EGLint n_rects);
+#define eglSwapBuffersWithDamageEXT EGLEW_GET_FUN(__eglewSwapBuffersWithDamageEXT)
+#define EGLEW_EXT_swap_buffers_with_damage EGLEW_GET_VAR(__EGLEW_EXT_swap_buffers_with_damage)
+#endif /* EGL_EXT_swap_buffers_with_damage */
+/* -------------------------- EGL_EXT_yuv_surface -------------------------- */
+#ifndef EGL_EXT_yuv_surface
+#define EGL_EXT_yuv_surface 1
+#define EGL_YUV_BUFFER_EXT 0x3300
+#define EGL_YUV_ORDER_EXT 0x3301
+#define EGL_YUV_ORDER_YUV_EXT 0x3302
+#define EGL_YUV_ORDER_YVU_EXT 0x3303
+#define EGL_YUV_ORDER_YUYV_EXT 0x3304
+#define EGL_YUV_ORDER_UYVY_EXT 0x3305
+#define EGL_YUV_ORDER_YVYU_EXT 0x3306
+#define EGL_YUV_ORDER_VYUY_EXT 0x3307
+#define EGL_YUV_ORDER_AYUV_EXT 0x3308
+#define EGL_YUV_CSC_STANDARD_601_EXT 0x330B
+#define EGL_YUV_CSC_STANDARD_709_EXT 0x330C
+#define EGL_YUV_CSC_STANDARD_2020_EXT 0x330D
+#define EGL_YUV_SUBSAMPLE_EXT 0x3312
+#define EGL_YUV_SUBSAMPLE_4_2_0_EXT 0x3313
+#define EGL_YUV_SUBSAMPLE_4_2_2_EXT 0x3314
+#define EGL_YUV_SUBSAMPLE_4_4_4_EXT 0x3315
+#define EGL_YUV_DEPTH_RANGE_EXT 0x3317
+#define EGL_YUV_PLANE_BPP_EXT 0x331A
+#define EGL_YUV_PLANE_BPP_0_EXT 0x331B
+#define EGL_YUV_PLANE_BPP_8_EXT 0x331C
+#define EGL_YUV_PLANE_BPP_10_EXT 0x331D
+#define EGLEW_EXT_yuv_surface EGLEW_GET_VAR(__EGLEW_EXT_yuv_surface)
+#endif /* EGL_EXT_yuv_surface */
+/* -------------------------- EGL_HI_clientpixmap -------------------------- */
+#ifndef EGL_HI_clientpixmap
+#define EGL_HI_clientpixmap 1
+typedef EGLSurface ( * PFNEGLCREATEPIXMAPSURFACEHIPROC) (EGLDisplay dpy, EGLConfig config, struct EGLClientPixmapHI * pixmap);
+#define eglCreatePixmapSurfaceHI EGLEW_GET_FUN(__eglewCreatePixmapSurfaceHI)
+#define EGLEW_HI_clientpixmap EGLEW_GET_VAR(__EGLEW_HI_clientpixmap)
+#endif /* EGL_HI_clientpixmap */
+/* -------------------------- EGL_HI_colorformats -------------------------- */
+#ifndef EGL_HI_colorformats
+#define EGL_HI_colorformats 1
+#define EGL_COLOR_FORMAT_HI 0x8F70
+#define EGL_COLOR_RGB_HI 0x8F71
+#define EGL_COLOR_RGBA_HI 0x8F72
+#define EGL_COLOR_ARGB_HI 0x8F73
+#define EGLEW_HI_colorformats EGLEW_GET_VAR(__EGLEW_HI_colorformats)
+#endif /* EGL_HI_colorformats */
+/* ------------------------ EGL_IMG_context_priority ----------------------- */
+#ifndef EGL_IMG_context_priority
+#define EGL_IMG_context_priority 1
+#define EGLEW_IMG_context_priority EGLEW_GET_VAR(__EGLEW_IMG_context_priority)
+#endif /* EGL_IMG_context_priority */
+/* ---------------------- EGL_IMG_image_plane_attribs ---------------------- */
+#ifndef EGL_IMG_image_plane_attribs
+#define EGL_IMG_image_plane_attribs 1
+#define EGLEW_IMG_image_plane_attribs EGLEW_GET_VAR(__EGLEW_IMG_image_plane_attribs)
+#endif /* EGL_IMG_image_plane_attribs */
+/* ---------------------------- EGL_KHR_cl_event --------------------------- */
+#ifndef EGL_KHR_cl_event
+#define EGL_KHR_cl_event 1
+#define EGLEW_KHR_cl_event EGLEW_GET_VAR(__EGLEW_KHR_cl_event)
+#endif /* EGL_KHR_cl_event */
+/* --------------------------- EGL_KHR_cl_event2 --------------------------- */
+#ifndef EGL_KHR_cl_event2
+#define EGL_KHR_cl_event2 1
+typedef EGLSyncKHR ( * PFNEGLCREATESYNC64KHRPROC) (EGLDisplay dpy, EGLenum type, const EGLAttribKHR * attrib_list);
+#define eglCreateSync64KHR EGLEW_GET_FUN(__eglewCreateSync64KHR)
+#define EGLEW_KHR_cl_event2 EGLEW_GET_VAR(__EGLEW_KHR_cl_event2)
+#endif /* EGL_KHR_cl_event2 */
+/* ----------------- EGL_KHR_client_get_all_proc_addresses ----------------- */
+#ifndef EGL_KHR_client_get_all_proc_addresses
+#define EGL_KHR_client_get_all_proc_addresses 1
+#define EGLEW_KHR_client_get_all_proc_addresses EGLEW_GET_VAR(__EGLEW_KHR_client_get_all_proc_addresses)
+#endif /* EGL_KHR_client_get_all_proc_addresses */
+/* ------------------------- EGL_KHR_config_attribs ------------------------ */
+#ifndef EGL_KHR_config_attribs
+#define EGL_KHR_config_attribs 1
+#define EGL_CONFORMANT_KHR 0x3042
+#define EGLEW_KHR_config_attribs EGLEW_GET_VAR(__EGLEW_KHR_config_attribs)
+#endif /* EGL_KHR_config_attribs */
+/* --------------------- EGL_KHR_context_flush_control --------------------- */
+#ifndef EGL_KHR_context_flush_control
+#define EGL_KHR_context_flush_control 1
+#define EGLEW_KHR_context_flush_control EGLEW_GET_VAR(__EGLEW_KHR_context_flush_control)
+#endif /* EGL_KHR_context_flush_control */
+/* ------------------------- EGL_KHR_create_context ------------------------ */
+#ifndef EGL_KHR_create_context
+#define EGL_KHR_create_context 1
+#define EGL_OPENGL_ES3_BIT 0x00000040
+#define EGL_OPENGL_ES3_BIT_KHR 0x00000040
+#define EGLEW_KHR_create_context EGLEW_GET_VAR(__EGLEW_KHR_create_context)
+#endif /* EGL_KHR_create_context */
+/* -------------------- EGL_KHR_create_context_no_error -------------------- */
+#ifndef EGL_KHR_create_context_no_error
+#define EGL_KHR_create_context_no_error 1
+#define EGLEW_KHR_create_context_no_error EGLEW_GET_VAR(__EGLEW_KHR_create_context_no_error)
+#endif /* EGL_KHR_create_context_no_error */
+/* ----------------------------- EGL_KHR_debug ----------------------------- */
+#ifndef EGL_KHR_debug
+#define EGL_KHR_debug 1
+#define EGL_OBJECT_IMAGE_KHR 0x33B4
+#define EGL_OBJECT_SYNC_KHR 0x33B5
+typedef EGLint ( * PFNEGLDEBUGMESSAGECONTROLKHRPROC) (EGLDEBUGPROCKHR callback, const EGLAttrib * attrib_list);
+typedef EGLint ( * PFNEGLLABELOBJECTKHRPROC) (EGLDisplay display, EGLenum objectType, EGLObjectKHR object, EGLLabelKHR label);
+typedef EGLBoolean ( * PFNEGLQUERYDEBUGKHRPROC) (EGLint attribute, EGLAttrib * value);
+#define eglDebugMessageControlKHR EGLEW_GET_FUN(__eglewDebugMessageControlKHR)
+#define eglLabelObjectKHR EGLEW_GET_FUN(__eglewLabelObjectKHR)
+#define eglQueryDebugKHR EGLEW_GET_FUN(__eglewQueryDebugKHR)
+#define EGLEW_KHR_debug EGLEW_GET_VAR(__EGLEW_KHR_debug)
+#endif /* EGL_KHR_debug */
+/* --------------------------- EGL_KHR_fence_sync -------------------------- */
+#ifndef EGL_KHR_fence_sync
+#define EGL_KHR_fence_sync 1
+#define EGL_SYNC_FENCE_KHR 0x30F9
+#define EGLEW_KHR_fence_sync EGLEW_GET_VAR(__EGLEW_KHR_fence_sync)
+#endif /* EGL_KHR_fence_sync */
+/* --------------------- EGL_KHR_get_all_proc_addresses -------------------- */
+#ifndef EGL_KHR_get_all_proc_addresses
+#define EGL_KHR_get_all_proc_addresses 1
+#define EGLEW_KHR_get_all_proc_addresses EGLEW_GET_VAR(__EGLEW_KHR_get_all_proc_addresses)
+#endif /* EGL_KHR_get_all_proc_addresses */
+/* ------------------------- EGL_KHR_gl_colorspace ------------------------- */
+#ifndef EGL_KHR_gl_colorspace
+#define EGL_KHR_gl_colorspace 1
+#define EGLEW_KHR_gl_colorspace EGLEW_GET_VAR(__EGLEW_KHR_gl_colorspace)
+#endif /* EGL_KHR_gl_colorspace */
+/* --------------------- EGL_KHR_gl_renderbuffer_image --------------------- */
+#ifndef EGL_KHR_gl_renderbuffer_image
+#define EGL_KHR_gl_renderbuffer_image 1
+#define EGLEW_KHR_gl_renderbuffer_image EGLEW_GET_VAR(__EGLEW_KHR_gl_renderbuffer_image)
+#endif /* EGL_KHR_gl_renderbuffer_image */
+/* ---------------------- EGL_KHR_gl_texture_2D_image ---------------------- */
+#ifndef EGL_KHR_gl_texture_2D_image
+#define EGL_KHR_gl_texture_2D_image 1
+#define EGL_GL_TEXTURE_2D_KHR 0x30B1
+#define EGLEW_KHR_gl_texture_2D_image EGLEW_GET_VAR(__EGLEW_KHR_gl_texture_2D_image)
+#endif /* EGL_KHR_gl_texture_2D_image */
+/* ---------------------- EGL_KHR_gl_texture_3D_image ---------------------- */
+#ifndef EGL_KHR_gl_texture_3D_image
+#define EGL_KHR_gl_texture_3D_image 1
+#define EGL_GL_TEXTURE_3D_KHR 0x30B2
+#define EGLEW_KHR_gl_texture_3D_image EGLEW_GET_VAR(__EGLEW_KHR_gl_texture_3D_image)
+#endif /* EGL_KHR_gl_texture_3D_image */
+/* -------------------- EGL_KHR_gl_texture_cubemap_image ------------------- */
+#ifndef EGL_KHR_gl_texture_cubemap_image
+#define EGL_KHR_gl_texture_cubemap_image 1
+#define EGLEW_KHR_gl_texture_cubemap_image EGLEW_GET_VAR(__EGLEW_KHR_gl_texture_cubemap_image)
+#endif /* EGL_KHR_gl_texture_cubemap_image */
+/* ----------------------------- EGL_KHR_image ----------------------------- */
+#ifndef EGL_KHR_image
+#define EGL_KHR_image 1
+typedef EGLImageKHR ( * PFNEGLCREATEIMAGEKHRPROC) (EGLDisplay dpy, EGLContext ctx, EGLenum target, EGLClientBuffer buffer, const EGLint * attrib_list);
+typedef EGLBoolean ( * PFNEGLDESTROYIMAGEKHRPROC) (EGLDisplay dpy, EGLImageKHR image);
+#define eglCreateImageKHR EGLEW_GET_FUN(__eglewCreateImageKHR)
+#define eglDestroyImageKHR EGLEW_GET_FUN(__eglewDestroyImageKHR)
+#define EGLEW_KHR_image EGLEW_GET_VAR(__EGLEW_KHR_image)
+#endif /* EGL_KHR_image */
+/* --------------------------- EGL_KHR_image_base -------------------------- */
+#ifndef EGL_KHR_image_base
+#define EGL_KHR_image_base 1
+#define EGLEW_KHR_image_base EGLEW_GET_VAR(__EGLEW_KHR_image_base)
+#endif /* EGL_KHR_image_base */
+/* -------------------------- EGL_KHR_image_pixmap ------------------------- */
+#ifndef EGL_KHR_image_pixmap
+#define EGL_KHR_image_pixmap 1
+#define EGLEW_KHR_image_pixmap EGLEW_GET_VAR(__EGLEW_KHR_image_pixmap)
+#endif /* EGL_KHR_image_pixmap */
+/* -------------------------- EGL_KHR_lock_surface ------------------------- */
+#ifndef EGL_KHR_lock_surface
+#define EGL_KHR_lock_surface 1
+#define EGL_READ_SURFACE_BIT_KHR 0x0001
+#define EGL_LOCK_SURFACE_BIT_KHR 0x0080
+#define EGL_MATCH_FORMAT_KHR 0x3043
+#define EGL_FORMAT_RGB_565_EXACT_KHR 0x30C0
+#define EGL_FORMAT_RGB_565_KHR 0x30C1
+#define EGL_FORMAT_RGBA_8888_EXACT_KHR 0x30C2
+#define EGL_FORMAT_RGBA_8888_KHR 0x30C3
+#define EGL_BITMAP_PITCH_KHR 0x30C7
+#define EGL_LOWER_LEFT_KHR 0x30CE
+#define EGL_UPPER_LEFT_KHR 0x30CF
+typedef EGLBoolean ( * PFNEGLLOCKSURFACEKHRPROC) (EGLDisplay dpy, EGLSurface surface, const EGLint * attrib_list);
+typedef EGLBoolean ( * PFNEGLUNLOCKSURFACEKHRPROC) (EGLDisplay dpy, EGLSurface surface);
+#define eglLockSurfaceKHR EGLEW_GET_FUN(__eglewLockSurfaceKHR)
+#define eglUnlockSurfaceKHR EGLEW_GET_FUN(__eglewUnlockSurfaceKHR)
+#define EGLEW_KHR_lock_surface EGLEW_GET_VAR(__EGLEW_KHR_lock_surface)
+#endif /* EGL_KHR_lock_surface */
+/* ------------------------- EGL_KHR_lock_surface2 ------------------------- */
+#ifndef EGL_KHR_lock_surface2
+#define EGL_KHR_lock_surface2 1
+#define EGLEW_KHR_lock_surface2 EGLEW_GET_VAR(__EGLEW_KHR_lock_surface2)
+#endif /* EGL_KHR_lock_surface2 */
+/* ------------------------- EGL_KHR_lock_surface3 ------------------------- */
+#ifndef EGL_KHR_lock_surface3
+#define EGL_KHR_lock_surface3 1
+#define EGL_READ_SURFACE_BIT_KHR 0x0001
+#define EGL_LOCK_SURFACE_BIT_KHR 0x0080
+#define EGL_MATCH_FORMAT_KHR 0x3043
+#define EGL_FORMAT_RGB_565_EXACT_KHR 0x30C0
+#define EGL_FORMAT_RGB_565_KHR 0x30C1
+#define EGL_FORMAT_RGBA_8888_EXACT_KHR 0x30C2
+#define EGL_FORMAT_RGBA_8888_KHR 0x30C3
+#define EGL_BITMAP_PITCH_KHR 0x30C7
+#define EGL_LOWER_LEFT_KHR 0x30CE
+#define EGL_UPPER_LEFT_KHR 0x30CF
+typedef EGLBoolean ( * PFNEGLQUERYSURFACE64KHRPROC) (EGLDisplay dpy, EGLSurface surface, EGLint attribute, EGLAttribKHR * value);
+#define eglQuerySurface64KHR EGLEW_GET_FUN(__eglewQuerySurface64KHR)
+#define EGLEW_KHR_lock_surface3 EGLEW_GET_VAR(__EGLEW_KHR_lock_surface3)
+#endif /* EGL_KHR_lock_surface3 */
+/* --------------------- EGL_KHR_mutable_render_buffer --------------------- */
+#ifndef EGL_KHR_mutable_render_buffer
+#define EGL_KHR_mutable_render_buffer 1
+#define EGLEW_KHR_mutable_render_buffer EGLEW_GET_VAR(__EGLEW_KHR_mutable_render_buffer)
+#endif /* EGL_KHR_mutable_render_buffer */
+/* ----------------------- EGL_KHR_no_config_context ----------------------- */
+#ifndef EGL_KHR_no_config_context
+#define EGL_KHR_no_config_context 1
+#define EGLEW_KHR_no_config_context EGLEW_GET_VAR(__EGLEW_KHR_no_config_context)
+#endif /* EGL_KHR_no_config_context */
+/* ------------------------- EGL_KHR_partial_update ------------------------ */
+#ifndef EGL_KHR_partial_update
+#define EGL_KHR_partial_update 1
+#define EGL_BUFFER_AGE_KHR 0x313D
+typedef EGLBoolean ( * PFNEGLSETDAMAGEREGIONKHRPROC) (EGLDisplay dpy, EGLSurface surface, EGLint * rects, EGLint n_rects);
+#define eglSetDamageRegionKHR EGLEW_GET_FUN(__eglewSetDamageRegionKHR)
+#define EGLEW_KHR_partial_update EGLEW_GET_VAR(__EGLEW_KHR_partial_update)
+#endif /* EGL_KHR_partial_update */
+/* ------------------------ EGL_KHR_platform_android ----------------------- */
+#ifndef EGL_KHR_platform_android
+#define EGL_KHR_platform_android 1
+#define EGLEW_KHR_platform_android EGLEW_GET_VAR(__EGLEW_KHR_platform_android)
+#endif /* EGL_KHR_platform_android */
+/* -------------------------- EGL_KHR_platform_gbm ------------------------- */
+#ifndef EGL_KHR_platform_gbm
+#define EGL_KHR_platform_gbm 1
+#define EGL_PLATFORM_GBM_KHR 0x31D7
+#define EGLEW_KHR_platform_gbm EGLEW_GET_VAR(__EGLEW_KHR_platform_gbm)
+#endif /* EGL_KHR_platform_gbm */
+/* ------------------------ EGL_KHR_platform_wayland ----------------------- */
+#ifndef EGL_KHR_platform_wayland
+#define EGL_KHR_platform_wayland 1
+#define EGLEW_KHR_platform_wayland EGLEW_GET_VAR(__EGLEW_KHR_platform_wayland)
+#endif /* EGL_KHR_platform_wayland */
+/* -------------------------- EGL_KHR_platform_x11 ------------------------- */
+#ifndef EGL_KHR_platform_x11
+#define EGL_KHR_platform_x11 1
+#define EGL_PLATFORM_X11_KHR 0x31D5
+#define EGLEW_KHR_platform_x11 EGLEW_GET_VAR(__EGLEW_KHR_platform_x11)
+#endif /* EGL_KHR_platform_x11 */
+/* ------------------------- EGL_KHR_reusable_sync ------------------------- */
+#ifndef EGL_KHR_reusable_sync
+#define EGL_KHR_reusable_sync 1
+#define EGL_SYNC_STATUS_KHR 0x30F1
+#define EGL_SIGNALED_KHR 0x30F2
+#define EGL_UNSIGNALED_KHR 0x30F3
+#define EGL_SYNC_TYPE_KHR 0x30F7
+typedef EGLint ( * PFNEGLCLIENTWAITSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint flags, EGLTimeKHR timeout);
+typedef EGLSyncKHR ( * PFNEGLCREATESYNCKHRPROC) (EGLDisplay dpy, EGLenum type, const EGLint * attrib_list);
+typedef EGLBoolean ( * PFNEGLDESTROYSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync);
+typedef EGLBoolean ( * PFNEGLGETSYNCATTRIBKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint attribute, EGLint * value);
+typedef EGLBoolean ( * PFNEGLSIGNALSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLenum mode);
+#define eglClientWaitSyncKHR EGLEW_GET_FUN(__eglewClientWaitSyncKHR)
+#define eglCreateSyncKHR EGLEW_GET_FUN(__eglewCreateSyncKHR)
+#define eglDestroySyncKHR EGLEW_GET_FUN(__eglewDestroySyncKHR)
+#define eglGetSyncAttribKHR EGLEW_GET_FUN(__eglewGetSyncAttribKHR)
+#define eglSignalSyncKHR EGLEW_GET_FUN(__eglewSignalSyncKHR)
+#define EGLEW_KHR_reusable_sync EGLEW_GET_VAR(__EGLEW_KHR_reusable_sync)
+#endif /* EGL_KHR_reusable_sync */
+/* ----------------------------- EGL_KHR_stream ---------------------------- */
+#ifndef EGL_KHR_stream
+#define EGL_KHR_stream 1
+#define EGL_PRODUCER_FRAME_KHR 0x3212
+#define EGL_CONSUMER_FRAME_KHR 0x3213
+#define EGL_STREAM_STATE_KHR 0x3214
+#define EGL_BAD_STREAM_KHR 0x321B
+#define EGL_BAD_STATE_KHR 0x321C
+typedef EGLStreamKHR ( * PFNEGLCREATESTREAMKHRPROC) (EGLDisplay dpy, const EGLint * attrib_list);
+typedef EGLBoolean ( * PFNEGLDESTROYSTREAMKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream);
+typedef EGLBoolean ( * PFNEGLQUERYSTREAMKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLint * value);
+typedef EGLBoolean ( * PFNEGLQUERYSTREAMU64KHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLuint64KHR * value);
+typedef EGLBoolean ( * PFNEGLSTREAMATTRIBKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLint value);
+#define eglCreateStreamKHR EGLEW_GET_FUN(__eglewCreateStreamKHR)
+#define eglDestroyStreamKHR EGLEW_GET_FUN(__eglewDestroyStreamKHR)
+#define eglQueryStreamKHR EGLEW_GET_FUN(__eglewQueryStreamKHR)
+#define eglQueryStreamu64KHR EGLEW_GET_FUN(__eglewQueryStreamu64KHR)
+#define eglStreamAttribKHR EGLEW_GET_FUN(__eglewStreamAttribKHR)
+#define EGLEW_KHR_stream EGLEW_GET_VAR(__EGLEW_KHR_stream)
+#endif /* EGL_KHR_stream */
+/* ------------------------- EGL_KHR_stream_attrib ------------------------- */
+#ifndef EGL_KHR_stream_attrib
+#define EGL_KHR_stream_attrib 1
+#define EGL_STREAM_STATE_KHR 0x3214
+typedef EGLStreamKHR ( * PFNEGLCREATESTREAMATTRIBKHRPROC) (EGLDisplay dpy, const EGLAttrib * attrib_list);
+typedef EGLBoolean ( * PFNEGLQUERYSTREAMATTRIBKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLAttrib * value);
+typedef EGLBoolean ( * PFNEGLSETSTREAMATTRIBKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLAttrib value);
+typedef EGLBoolean ( * PFNEGLSTREAMCONSUMERACQUIREATTRIBKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, const EGLAttrib * attrib_list);
+typedef EGLBoolean ( * PFNEGLSTREAMCONSUMERRELEASEATTRIBKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, const EGLAttrib * attrib_list);
+#define eglCreateStreamAttribKHR EGLEW_GET_FUN(__eglewCreateStreamAttribKHR)
+#define eglQueryStreamAttribKHR EGLEW_GET_FUN(__eglewQueryStreamAttribKHR)
+#define eglSetStreamAttribKHR EGLEW_GET_FUN(__eglewSetStreamAttribKHR)
+#define eglStreamConsumerAcquireAttribKHR EGLEW_GET_FUN(__eglewStreamConsumerAcquireAttribKHR)
+#define eglStreamConsumerReleaseAttribKHR EGLEW_GET_FUN(__eglewStreamConsumerReleaseAttribKHR)
+#define EGLEW_KHR_stream_attrib EGLEW_GET_VAR(__EGLEW_KHR_stream_attrib)
+#endif /* EGL_KHR_stream_attrib */
+/* ------------------- EGL_KHR_stream_consumer_gltexture ------------------- */
+#ifndef EGL_KHR_stream_consumer_gltexture
+#define EGL_KHR_stream_consumer_gltexture 1
+typedef EGLBoolean ( * PFNEGLSTREAMCONSUMERACQUIREKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream);
+typedef EGLBoolean ( * PFNEGLSTREAMCONSUMERRELEASEKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream);
+#define eglStreamConsumerAcquireKHR EGLEW_GET_FUN(__eglewStreamConsumerAcquireKHR)
+#define eglStreamConsumerGLTextureExternalKHR EGLEW_GET_FUN(__eglewStreamConsumerGLTextureExternalKHR)
+#define eglStreamConsumerReleaseKHR EGLEW_GET_FUN(__eglewStreamConsumerReleaseKHR)
+#define EGLEW_KHR_stream_consumer_gltexture EGLEW_GET_VAR(__EGLEW_KHR_stream_consumer_gltexture)
+#endif /* EGL_KHR_stream_consumer_gltexture */
+/* -------------------- EGL_KHR_stream_cross_process_fd -------------------- */
+#ifndef EGL_KHR_stream_cross_process_fd
+#define EGL_KHR_stream_cross_process_fd 1
+typedef EGLStreamKHR ( * PFNEGLCREATESTREAMFROMFILEDESCRIPTORKHRPROC) (EGLDisplay dpy, EGLNativeFileDescriptorKHR file_descriptor);
+typedef EGLNativeFileDescriptorKHR ( * PFNEGLGETSTREAMFILEDESCRIPTORKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream);
+#define eglCreateStreamFromFileDescriptorKHR EGLEW_GET_FUN(__eglewCreateStreamFromFileDescriptorKHR)
+#define eglGetStreamFileDescriptorKHR EGLEW_GET_FUN(__eglewGetStreamFileDescriptorKHR)
+#define EGLEW_KHR_stream_cross_process_fd EGLEW_GET_VAR(__EGLEW_KHR_stream_cross_process_fd)
+#endif /* EGL_KHR_stream_cross_process_fd */
+/* -------------------------- EGL_KHR_stream_fifo -------------------------- */
+#ifndef EGL_KHR_stream_fifo
+#define EGL_KHR_stream_fifo 1
+typedef EGLBoolean ( * PFNEGLQUERYSTREAMTIMEKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLTimeKHR * value);
+#define eglQueryStreamTimeKHR EGLEW_GET_FUN(__eglewQueryStreamTimeKHR)
+#define EGLEW_KHR_stream_fifo EGLEW_GET_VAR(__EGLEW_KHR_stream_fifo)
+#endif /* EGL_KHR_stream_fifo */
+/* ----------------- EGL_KHR_stream_producer_aldatalocator ----------------- */
+#ifndef EGL_KHR_stream_producer_aldatalocator
+#define EGL_KHR_stream_producer_aldatalocator 1
+#define EGLEW_KHR_stream_producer_aldatalocator EGLEW_GET_VAR(__EGLEW_KHR_stream_producer_aldatalocator)
+#endif /* EGL_KHR_stream_producer_aldatalocator */
+/* ------------------- EGL_KHR_stream_producer_eglsurface ------------------ */
+#ifndef EGL_KHR_stream_producer_eglsurface
+#define EGL_KHR_stream_producer_eglsurface 1
+#define EGL_STREAM_BIT_KHR 0x0800
+typedef EGLSurface ( * PFNEGLCREATESTREAMPRODUCERSURFACEKHRPROC) (EGLDisplay dpy, EGLConfig config, EGLStreamKHR stream, const EGLint * attrib_list);
+#define eglCreateStreamProducerSurfaceKHR EGLEW_GET_FUN(__eglewCreateStreamProducerSurfaceKHR)
+#define EGLEW_KHR_stream_producer_eglsurface EGLEW_GET_VAR(__EGLEW_KHR_stream_producer_eglsurface)
+#endif /* EGL_KHR_stream_producer_eglsurface */
+/* ---------------------- EGL_KHR_surfaceless_context ---------------------- */
+#ifndef EGL_KHR_surfaceless_context
+#define EGL_KHR_surfaceless_context 1
+#define EGLEW_KHR_surfaceless_context EGLEW_GET_VAR(__EGLEW_KHR_surfaceless_context)
+#endif /* EGL_KHR_surfaceless_context */
+/* -------------------- EGL_KHR_swap_buffers_with_damage ------------------- */
+#ifndef EGL_KHR_swap_buffers_with_damage
+#define EGL_KHR_swap_buffers_with_damage 1
+typedef EGLBoolean ( * PFNEGLSWAPBUFFERSWITHDAMAGEKHRPROC) (EGLDisplay dpy, EGLSurface surface, EGLint * rects, EGLint n_rects);
+#define eglSwapBuffersWithDamageKHR EGLEW_GET_FUN(__eglewSwapBuffersWithDamageKHR)
+#define EGLEW_KHR_swap_buffers_with_damage EGLEW_GET_VAR(__EGLEW_KHR_swap_buffers_with_damage)
+#endif /* EGL_KHR_swap_buffers_with_damage */
+/* ------------------------ EGL_KHR_vg_parent_image ------------------------ */
+#ifndef EGL_KHR_vg_parent_image
+#define EGL_KHR_vg_parent_image 1
+#define EGLEW_KHR_vg_parent_image EGLEW_GET_VAR(__EGLEW_KHR_vg_parent_image)
+#endif /* EGL_KHR_vg_parent_image */
+/* --------------------------- EGL_KHR_wait_sync --------------------------- */
+#ifndef EGL_KHR_wait_sync
+#define EGL_KHR_wait_sync 1
+typedef EGLint ( * PFNEGLWAITSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint flags);
+#define eglWaitSyncKHR EGLEW_GET_FUN(__eglewWaitSyncKHR)
+#define EGLEW_KHR_wait_sync EGLEW_GET_VAR(__EGLEW_KHR_wait_sync)
+#endif /* EGL_KHR_wait_sync */
+/* --------------------------- EGL_MESA_drm_image -------------------------- */
+#ifndef EGL_MESA_drm_image
+#define EGL_MESA_drm_image 1
+#define EGL_DRM_BUFFER_USE_SHARE_MESA 0x00000002
+#define EGL_DRM_BUFFER_MESA 0x31D3
+typedef EGLImageKHR ( * PFNEGLCREATEDRMIMAGEMESAPROC) (EGLDisplay dpy, const EGLint * attrib_list);
+typedef EGLBoolean ( * PFNEGLEXPORTDRMIMAGEMESAPROC) (EGLDisplay dpy, EGLImageKHR image, EGLint * name, EGLint * handle, EGLint * stride);
+#define eglCreateDRMImageMESA EGLEW_GET_FUN(__eglewCreateDRMImageMESA)
+#define eglExportDRMImageMESA EGLEW_GET_FUN(__eglewExportDRMImageMESA)
+#define EGLEW_MESA_drm_image EGLEW_GET_VAR(__EGLEW_MESA_drm_image)
+#endif /* EGL_MESA_drm_image */
+/* --------------------- EGL_MESA_image_dma_buf_export --------------------- */
+#ifndef EGL_MESA_image_dma_buf_export
+#define EGL_MESA_image_dma_buf_export 1
+typedef EGLBoolean ( * PFNEGLEXPORTDMABUFIMAGEMESAPROC) (EGLDisplay dpy, EGLImageKHR image, int * fds, EGLint * strides, EGLint * offsets);
+typedef EGLBoolean ( * PFNEGLEXPORTDMABUFIMAGEQUERYMESAPROC) (EGLDisplay dpy, EGLImageKHR image, int * fourcc, int * num_planes, EGLuint64KHR * modifiers);
+#define eglExportDMABUFImageMESA EGLEW_GET_FUN(__eglewExportDMABUFImageMESA)
+#define eglExportDMABUFImageQueryMESA EGLEW_GET_FUN(__eglewExportDMABUFImageQueryMESA)
+#define EGLEW_MESA_image_dma_buf_export EGLEW_GET_VAR(__EGLEW_MESA_image_dma_buf_export)
+#endif /* EGL_MESA_image_dma_buf_export */
+/* ------------------------- EGL_MESA_platform_gbm ------------------------- */
+#ifndef EGL_MESA_platform_gbm
+#define EGL_MESA_platform_gbm 1
+#define EGLEW_MESA_platform_gbm EGLEW_GET_VAR(__EGLEW_MESA_platform_gbm)
+#endif /* EGL_MESA_platform_gbm */
+/* --------------------- EGL_MESA_platform_surfaceless --------------------- */
+#ifndef EGL_MESA_platform_surfaceless
+#define EGL_MESA_platform_surfaceless 1
+#define EGLEW_MESA_platform_surfaceless EGLEW_GET_VAR(__EGLEW_MESA_platform_surfaceless)
+#endif /* EGL_MESA_platform_surfaceless */
+/* -------------------------- EGL_NOK_swap_region -------------------------- */
+#ifndef EGL_NOK_swap_region
+#define EGL_NOK_swap_region 1
+typedef EGLBoolean ( * PFNEGLSWAPBUFFERSREGIONNOKPROC) (EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint * rects);
+#define eglSwapBuffersRegionNOK EGLEW_GET_FUN(__eglewSwapBuffersRegionNOK)
+#define EGLEW_NOK_swap_region EGLEW_GET_VAR(__EGLEW_NOK_swap_region)
+#endif /* EGL_NOK_swap_region */
+/* -------------------------- EGL_NOK_swap_region2 ------------------------- */
+#ifndef EGL_NOK_swap_region2
+#define EGL_NOK_swap_region2 1
+typedef EGLBoolean ( * PFNEGLSWAPBUFFERSREGION2NOKPROC) (EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint * rects);
+#define eglSwapBuffersRegion2NOK EGLEW_GET_FUN(__eglewSwapBuffersRegion2NOK)
+#define EGLEW_NOK_swap_region2 EGLEW_GET_VAR(__EGLEW_NOK_swap_region2)
+#endif /* EGL_NOK_swap_region2 */
+/* ---------------------- EGL_NOK_texture_from_pixmap ---------------------- */
+#ifndef EGL_NOK_texture_from_pixmap
+#define EGL_NOK_texture_from_pixmap 1
+#define EGL_Y_INVERTED_NOK 0x307F
+#define EGLEW_NOK_texture_from_pixmap EGLEW_GET_VAR(__EGLEW_NOK_texture_from_pixmap)
+#endif /* EGL_NOK_texture_from_pixmap */
+/* ------------------------ EGL_NV_3dvision_surface ------------------------ */
+#ifndef EGL_NV_3dvision_surface
+#define EGL_NV_3dvision_surface 1
+#define EGL_AUTO_STEREO_NV 0x3136
+#define EGLEW_NV_3dvision_surface EGLEW_GET_VAR(__EGLEW_NV_3dvision_surface)
+#endif /* EGL_NV_3dvision_surface */
+/* ------------------------- EGL_NV_coverage_sample ------------------------ */
+#ifndef EGL_NV_coverage_sample
+#define EGL_NV_coverage_sample 1
+#define EGLEW_NV_coverage_sample EGLEW_GET_VAR(__EGLEW_NV_coverage_sample)
+#endif /* EGL_NV_coverage_sample */
+/* --------------------- EGL_NV_coverage_sample_resolve -------------------- */
+#ifndef EGL_NV_coverage_sample_resolve
+#define EGL_NV_coverage_sample_resolve 1
+#define EGLEW_NV_coverage_sample_resolve EGLEW_GET_VAR(__EGLEW_NV_coverage_sample_resolve)
+#endif /* EGL_NV_coverage_sample_resolve */
+/* --------------------------- EGL_NV_cuda_event --------------------------- */
+#ifndef EGL_NV_cuda_event
+#define EGL_NV_cuda_event 1
+#define EGL_SYNC_CUDA_EVENT_NV 0x323C
+#define EGLEW_NV_cuda_event EGLEW_GET_VAR(__EGLEW_NV_cuda_event)
+#endif /* EGL_NV_cuda_event */
+/* ------------------------- EGL_NV_depth_nonlinear ------------------------ */
+#ifndef EGL_NV_depth_nonlinear
+#define EGL_NV_depth_nonlinear 1
+#define EGLEW_NV_depth_nonlinear EGLEW_GET_VAR(__EGLEW_NV_depth_nonlinear)
+#endif /* EGL_NV_depth_nonlinear */
+/* --------------------------- EGL_NV_device_cuda -------------------------- */
+#ifndef EGL_NV_device_cuda
+#define EGL_NV_device_cuda 1
+#define EGL_CUDA_DEVICE_NV 0x323A
+#define EGLEW_NV_device_cuda EGLEW_GET_VAR(__EGLEW_NV_device_cuda)
+#endif /* EGL_NV_device_cuda */
+/* -------------------------- EGL_NV_native_query -------------------------- */
+#ifndef EGL_NV_native_query
+#define EGL_NV_native_query 1
+typedef EGLBoolean ( * PFNEGLQUERYNATIVEDISPLAYNVPROC) (EGLDisplay dpy, EGLNativeDisplayType * display_id);
+typedef EGLBoolean ( * PFNEGLQUERYNATIVEPIXMAPNVPROC) (EGLDisplay dpy, EGLSurface surf, EGLNativePixmapType * pixmap);
+typedef EGLBoolean ( * PFNEGLQUERYNATIVEWINDOWNVPROC) (EGLDisplay dpy, EGLSurface surf, EGLNativeWindowType * window);
+#define eglQueryNativeDisplayNV EGLEW_GET_FUN(__eglewQueryNativeDisplayNV)
+#define eglQueryNativePixmapNV EGLEW_GET_FUN(__eglewQueryNativePixmapNV)
+#define eglQueryNativeWindowNV EGLEW_GET_FUN(__eglewQueryNativeWindowNV)
+#define EGLEW_NV_native_query EGLEW_GET_VAR(__EGLEW_NV_native_query)
+#endif /* EGL_NV_native_query */
+/* ---------------------- EGL_NV_post_convert_rounding --------------------- */
+#ifndef EGL_NV_post_convert_rounding
+#define EGL_NV_post_convert_rounding 1
+#define EGLEW_NV_post_convert_rounding EGLEW_GET_VAR(__EGLEW_NV_post_convert_rounding)
+#endif /* EGL_NV_post_convert_rounding */
+/* ------------------------- EGL_NV_post_sub_buffer ------------------------ */
+#ifndef EGL_NV_post_sub_buffer
+#define EGL_NV_post_sub_buffer 1
+typedef EGLBoolean ( * PFNEGLPOSTSUBBUFFERNVPROC) (EGLDisplay dpy, EGLSurface surface, EGLint x, EGLint y, EGLint width, EGLint height);
+#define eglPostSubBufferNV EGLEW_GET_FUN(__eglewPostSubBufferNV)
+#define EGLEW_NV_post_sub_buffer EGLEW_GET_VAR(__EGLEW_NV_post_sub_buffer)
+#endif /* EGL_NV_post_sub_buffer */
+/* ------------------ EGL_NV_robustness_video_memory_purge ----------------- */
+#ifndef EGL_NV_robustness_video_memory_purge
+#define EGL_NV_robustness_video_memory_purge 1
+#define EGLEW_NV_robustness_video_memory_purge EGLEW_GET_VAR(__EGLEW_NV_robustness_video_memory_purge)
+#endif /* EGL_NV_robustness_video_memory_purge */
+/* ------------------ EGL_NV_stream_consumer_gltexture_yuv ----------------- */
+#ifndef EGL_NV_stream_consumer_gltexture_yuv
+#define EGL_NV_stream_consumer_gltexture_yuv 1
+#define EGL_YUV_BUFFER_EXT 0x3300
+typedef EGLBoolean ( * PFNEGLSTREAMCONSUMERGLTEXTUREEXTERNALATTRIBSNVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLAttrib *attrib_list);
+#define eglStreamConsumerGLTextureExternalAttribsNV EGLEW_GET_FUN(__eglewStreamConsumerGLTextureExternalAttribsNV)
+#define EGLEW_NV_stream_consumer_gltexture_yuv EGLEW_GET_VAR(__EGLEW_NV_stream_consumer_gltexture_yuv)
+#endif /* EGL_NV_stream_consumer_gltexture_yuv */
+/* ---------------------- EGL_NV_stream_cross_display ---------------------- */
+#ifndef EGL_NV_stream_cross_display
+#define EGL_NV_stream_cross_display 1
+#define EGLEW_NV_stream_cross_display EGLEW_GET_VAR(__EGLEW_NV_stream_cross_display)
+#endif /* EGL_NV_stream_cross_display */
+/* ----------------------- EGL_NV_stream_cross_object ---------------------- */
+#ifndef EGL_NV_stream_cross_object
+#define EGL_NV_stream_cross_object 1
+#define EGLEW_NV_stream_cross_object EGLEW_GET_VAR(__EGLEW_NV_stream_cross_object)
+#endif /* EGL_NV_stream_cross_object */
+/* --------------------- EGL_NV_stream_cross_partition --------------------- */
+#ifndef EGL_NV_stream_cross_partition
+#define EGL_NV_stream_cross_partition 1
+#define EGLEW_NV_stream_cross_partition EGLEW_GET_VAR(__EGLEW_NV_stream_cross_partition)
+#endif /* EGL_NV_stream_cross_partition */
+/* ---------------------- EGL_NV_stream_cross_process ---------------------- */
+#ifndef EGL_NV_stream_cross_process
+#define EGL_NV_stream_cross_process 1
+#define EGLEW_NV_stream_cross_process EGLEW_GET_VAR(__EGLEW_NV_stream_cross_process)
+#endif /* EGL_NV_stream_cross_process */
+/* ----------------------- EGL_NV_stream_cross_system ---------------------- */
+#ifndef EGL_NV_stream_cross_system
+#define EGL_NV_stream_cross_system 1
+#define EGLEW_NV_stream_cross_system EGLEW_GET_VAR(__EGLEW_NV_stream_cross_system)
+#endif /* EGL_NV_stream_cross_system */
+/* ------------------------ EGL_NV_stream_fifo_next ------------------------ */
+#ifndef EGL_NV_stream_fifo_next
+#define EGL_NV_stream_fifo_next 1
+#define EGL_PENDING_FRAME_NV 0x3329
+#define EGLEW_NV_stream_fifo_next EGLEW_GET_VAR(__EGLEW_NV_stream_fifo_next)
+#endif /* EGL_NV_stream_fifo_next */
+/* --------------------- EGL_NV_stream_fifo_synchronous -------------------- */
+#ifndef EGL_NV_stream_fifo_synchronous
+#define EGL_NV_stream_fifo_synchronous 1
+#define EGLEW_NV_stream_fifo_synchronous EGLEW_GET_VAR(__EGLEW_NV_stream_fifo_synchronous)
+#endif /* EGL_NV_stream_fifo_synchronous */
+/* ----------------------- EGL_NV_stream_frame_limits ---------------------- */
+#ifndef EGL_NV_stream_frame_limits
+#define EGL_NV_stream_frame_limits 1
+#define EGLEW_NV_stream_frame_limits EGLEW_GET_VAR(__EGLEW_NV_stream_frame_limits)
+#endif /* EGL_NV_stream_frame_limits */
+/* ------------------------- EGL_NV_stream_metadata ------------------------ */
+#ifndef EGL_NV_stream_metadata
+#define EGL_NV_stream_metadata 1
+#define EGL_METADATA0_SIZE_NV 0x3255
+#define EGL_METADATA1_SIZE_NV 0x3256
+#define EGL_METADATA2_SIZE_NV 0x3257
+#define EGL_METADATA3_SIZE_NV 0x3258
+#define EGL_METADATA0_TYPE_NV 0x3259
+#define EGL_METADATA1_TYPE_NV 0x325A
+#define EGL_METADATA2_TYPE_NV 0x325B
+#define EGL_METADATA3_TYPE_NV 0x325C
+typedef EGLBoolean ( * PFNEGLQUERYDISPLAYATTRIBNVPROC) (EGLDisplay dpy, EGLint attribute, EGLAttrib * value);
+typedef EGLBoolean ( * PFNEGLQUERYSTREAMMETADATANVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum name, EGLint n, EGLint offset, EGLint size, void * data);
+typedef EGLBoolean ( * PFNEGLSETSTREAMMETADATANVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLint n, EGLint offset, EGLint size, const void * data);
+#define eglQueryDisplayAttribNV EGLEW_GET_FUN(__eglewQueryDisplayAttribNV)
+#define eglQueryStreamMetadataNV EGLEW_GET_FUN(__eglewQueryStreamMetadataNV)
+#define eglSetStreamMetadataNV EGLEW_GET_FUN(__eglewSetStreamMetadataNV)
+#define EGLEW_NV_stream_metadata EGLEW_GET_VAR(__EGLEW_NV_stream_metadata)
+#endif /* EGL_NV_stream_metadata */
+/* -------------------------- EGL_NV_stream_remote ------------------------- */
+#ifndef EGL_NV_stream_remote
+#define EGL_NV_stream_remote 1
+#define EGL_STREAM_TYPE_NV 0x3241
+#define EGL_STREAM_PROTOCOL_NV 0x3242
+#define EGL_STREAM_ENDPOINT_NV 0x3243
+#define EGL_STREAM_LOCAL_NV 0x3244
+#define EGL_STREAM_PRODUCER_NV 0x3247
+#define EGL_STREAM_CONSUMER_NV 0x3248
+#define EGLEW_NV_stream_remote EGLEW_GET_VAR(__EGLEW_NV_stream_remote)
+#endif /* EGL_NV_stream_remote */
+/* -------------------------- EGL_NV_stream_reset -------------------------- */
+#ifndef EGL_NV_stream_reset
+#define EGL_NV_stream_reset 1
+#define EGL_SUPPORT_RESET_NV 0x3334
+#define EGL_SUPPORT_REUSE_NV 0x3335
+typedef EGLBoolean ( * PFNEGLRESETSTREAMNVPROC) (EGLDisplay dpy, EGLStreamKHR stream);
+#define eglResetStreamNV EGLEW_GET_FUN(__eglewResetStreamNV)
+#define EGLEW_NV_stream_reset EGLEW_GET_VAR(__EGLEW_NV_stream_reset)
+#endif /* EGL_NV_stream_reset */
+/* -------------------------- EGL_NV_stream_socket ------------------------- */
+#ifndef EGL_NV_stream_socket
+#define EGL_NV_stream_socket 1
+#define EGL_SOCKET_HANDLE_NV 0x324C
+#define EGL_SOCKET_TYPE_NV 0x324D
+#define EGLEW_NV_stream_socket EGLEW_GET_VAR(__EGLEW_NV_stream_socket)
+#endif /* EGL_NV_stream_socket */
+/* ----------------------- EGL_NV_stream_socket_inet ----------------------- */
+#ifndef EGL_NV_stream_socket_inet
+#define EGL_NV_stream_socket_inet 1
+#define EGLEW_NV_stream_socket_inet EGLEW_GET_VAR(__EGLEW_NV_stream_socket_inet)
+#endif /* EGL_NV_stream_socket_inet */
+/* ----------------------- EGL_NV_stream_socket_unix ----------------------- */
+#ifndef EGL_NV_stream_socket_unix
+#define EGL_NV_stream_socket_unix 1
+#define EGLEW_NV_stream_socket_unix EGLEW_GET_VAR(__EGLEW_NV_stream_socket_unix)
+#endif /* EGL_NV_stream_socket_unix */
+/* --------------------------- EGL_NV_stream_sync -------------------------- */
+#ifndef EGL_NV_stream_sync
+#define EGL_NV_stream_sync 1
+#define EGL_SYNC_TYPE_KHR 0x30F7
+#define EGL_SYNC_NEW_FRAME_NV 0x321F
+typedef EGLSyncKHR ( * PFNEGLCREATESTREAMSYNCNVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum type, const EGLint * attrib_list);
+#define eglCreateStreamSyncNV EGLEW_GET_FUN(__eglewCreateStreamSyncNV)
+#define EGLEW_NV_stream_sync EGLEW_GET_VAR(__EGLEW_NV_stream_sync)
+#endif /* EGL_NV_stream_sync */
+/* ------------------------------ EGL_NV_sync ------------------------------ */
+#ifndef EGL_NV_sync
+#define EGL_NV_sync 1
+#define EGL_SYNC_STATUS_NV 0x30E7
+#define EGL_SIGNALED_NV 0x30E8
+#define EGL_UNSIGNALED_NV 0x30E9
+#define EGL_SYNC_TYPE_NV 0x30ED
+#define EGL_SYNC_FENCE_NV 0x30EF
+typedef EGLint ( * PFNEGLCLIENTWAITSYNCNVPROC) (EGLSyncNV sync, EGLint flags, EGLTimeNV timeout);
+typedef EGLSyncNV ( * PFNEGLCREATEFENCESYNCNVPROC) (EGLDisplay dpy, EGLenum condition, const EGLint * attrib_list);
+typedef EGLBoolean ( * PFNEGLDESTROYSYNCNVPROC) (EGLSyncNV sync);
+typedef EGLBoolean ( * PFNEGLFENCENVPROC) (EGLSyncNV sync);
+typedef EGLBoolean ( * PFNEGLGETSYNCATTRIBNVPROC) (EGLSyncNV sync, EGLint attribute, EGLint * value);
+typedef EGLBoolean ( * PFNEGLSIGNALSYNCNVPROC) (EGLSyncNV sync, EGLenum mode);
+#define eglClientWaitSyncNV EGLEW_GET_FUN(__eglewClientWaitSyncNV)
+#define eglCreateFenceSyncNV EGLEW_GET_FUN(__eglewCreateFenceSyncNV)
+#define eglDestroySyncNV EGLEW_GET_FUN(__eglewDestroySyncNV)
+#define eglFenceNV EGLEW_GET_FUN(__eglewFenceNV)
+#define eglGetSyncAttribNV EGLEW_GET_FUN(__eglewGetSyncAttribNV)
+#define eglSignalSyncNV EGLEW_GET_FUN(__eglewSignalSyncNV)
+#define EGLEW_NV_sync EGLEW_GET_VAR(__EGLEW_NV_sync)
+#endif /* EGL_NV_sync */
+/* --------------------------- EGL_NV_system_time -------------------------- */
+#ifndef EGL_NV_system_time
+#define EGL_NV_system_time 1
+typedef EGLuint64NV ( * PFNEGLGETSYSTEMTIMENVPROC) ( void );
+#define eglGetSystemTimeFrequencyNV EGLEW_GET_FUN(__eglewGetSystemTimeFrequencyNV)
+#define eglGetSystemTimeNV EGLEW_GET_FUN(__eglewGetSystemTimeNV)
+#define EGLEW_NV_system_time EGLEW_GET_VAR(__EGLEW_NV_system_time)
+#endif /* EGL_NV_system_time */
+/* --------------------- EGL_TIZEN_image_native_buffer --------------------- */
+#ifndef EGL_TIZEN_image_native_buffer
+#define EGL_TIZEN_image_native_buffer 1
+#define EGLEW_TIZEN_image_native_buffer EGLEW_GET_VAR(__EGLEW_TIZEN_image_native_buffer)
+#endif /* EGL_TIZEN_image_native_buffer */
+/* --------------------- EGL_TIZEN_image_native_surface -------------------- */
+#ifndef EGL_TIZEN_image_native_surface
+#define EGL_TIZEN_image_native_surface 1
+#define EGLEW_TIZEN_image_native_surface EGLEW_GET_VAR(__EGLEW_TIZEN_image_native_surface)
+#endif /* EGL_TIZEN_image_native_surface */
+/* ------------------------------------------------------------------------- */
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_create_native_client_buffer;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_framebuffer_target;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_front_buffer_auto_refresh;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_image_native_buffer;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_native_fence_sync;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_presentation_time;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANGLE_d3d_share_handle_client_buffer;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANGLE_device_d3d;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANGLE_query_surface_pointer;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANGLE_surface_d3d_texture_2d_share_handle;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANGLE_window_fixed_size;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ARM_implicit_external_sync;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ARM_pixmap_multisample_discard;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_buffer_age;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_client_extensions;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_create_context_robustness;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_device_base;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_device_drm;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_device_enumeration;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_device_openwf;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_device_query;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_gl_colorspace_bt2020_linear;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_gl_colorspace_bt2020_pq;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_gl_colorspace_scrgb_linear;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_image_dma_buf_import;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_image_dma_buf_import_modifiers;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_multiview_window;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_output_base;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_output_drm;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_output_openwf;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_pixel_format_float;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_platform_base;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_platform_device;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_platform_wayland;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_platform_x11;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_protected_content;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_protected_surface;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_stream_consumer_egloutput;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_surface_SMPTE2086_metadata;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_swap_buffers_with_damage;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_yuv_surface;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_HI_clientpixmap;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_HI_colorformats;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_IMG_context_priority;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_IMG_image_plane_attribs;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_cl_event;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_cl_event2;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_client_get_all_proc_addresses;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_config_attribs;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_context_flush_control;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_create_context;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_create_context_no_error;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_fence_sync;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_get_all_proc_addresses;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_gl_colorspace;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_gl_renderbuffer_image;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_gl_texture_2D_image;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_gl_texture_3D_image;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_gl_texture_cubemap_image;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_image_base;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_image_pixmap;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_lock_surface;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_lock_surface2;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_lock_surface3;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_mutable_render_buffer;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_no_config_context;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_partial_update;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_platform_android;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_platform_gbm;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_platform_wayland;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_platform_x11;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_reusable_sync;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_attrib;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_consumer_gltexture;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_cross_process_fd;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_fifo;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_producer_aldatalocator;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_producer_eglsurface;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_surfaceless_context;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_swap_buffers_with_damage;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_vg_parent_image;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_wait_sync;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_MESA_drm_image;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_MESA_image_dma_buf_export;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_MESA_platform_gbm;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_MESA_platform_surfaceless;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NOK_swap_region;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NOK_swap_region2;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NOK_texture_from_pixmap;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_3dvision_surface;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_coverage_sample;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_coverage_sample_resolve;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_cuda_event;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_depth_nonlinear;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_device_cuda;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_native_query;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_post_convert_rounding;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_post_sub_buffer;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_robustness_video_memory_purge;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_consumer_gltexture_yuv;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_cross_display;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_cross_object;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_cross_partition;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_cross_process;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_cross_system;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_fifo_next;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_fifo_synchronous;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_frame_limits;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_metadata;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_remote;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_reset;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_socket;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_socket_inet;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_socket_unix;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_sync;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_system_time;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_TIZEN_image_native_buffer;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_TIZEN_image_native_surface;
+/* ------------------------------------------------------------------------ */
+GLEWAPI GLenum GLEWAPIENTRY eglewInit (EGLDisplay display);
+GLEWAPI GLboolean GLEWAPIENTRY eglewIsSupported (const char *name);
+#define EGLEW_GET_VAR(x) (*(const GLboolean*)&x)
+#define EGLEW_GET_FUN(x) x
+GLEWAPI GLboolean GLEWAPIENTRY eglewGetExtension (const char *name);
+#ifdef __cplusplus
+#endif /* __eglew_h__ */
diff --git a/subprojects/d2tk/glew-2.1.0/GL/glew.h b/subprojects/d2tk/glew-2.1.0/GL/glew.h
new file mode 100644
index 0000000..b5b6987
--- /dev/null
+++ b/subprojects/d2tk/glew-2.1.0/GL/glew.h
@@ -0,0 +1,23686 @@
+** The OpenGL Extension Wrangler Library
+** Copyright (C) 2008-2017, Nigel Stewart <nigels[]users sourceforge net>
+** Copyright (C) 2002-2008, Milan Ikits <milan ikits[]ieee org>
+** Copyright (C) 2002-2008, Marcelo E. Magallon <mmagallo[]debian org>
+** Copyright (C) 2002, Lev Povalahev
+** All rights reserved.
+** Redistribution and use in source and binary forms, with or without
+** modification, are permitted provided that the following conditions are met:
+** * Redistributions of source code must retain the above copyright notice,
+** this list of conditions and the following disclaimer.
+** * Redistributions in binary form must reproduce the above copyright notice,
+** this list of conditions and the following disclaimer in the documentation
+** and/or other materials provided with the distribution.
+** * The name of the author may be used to endorse or promote products
+** derived from this software without specific prior written permission.
+ * Mesa 3-D graphics library
+ * Version: 7.0
+ *
+ * Copyright (C) 1999-2007 Brian Paul All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the "Software"),
+ * to deal in the Software without restriction, including without limitation
+ * the rights to use, copy, modify, merge, publish, distribute, sublicense,
+ * and/or sell copies of the Software, and to permit persons to whom the
+ * Software is furnished to do so, subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included
+ * in all copies or substantial portions of the Software.
+ *
+ */
+** Copyright (c) 2007 The Khronos Group Inc.
+** Permission is hereby granted, free of charge, to any person obtaining a
+** copy of this software and/or associated documentation files (the
+** "Materials"), to deal in the Materials without restriction, including
+** without limitation the rights to use, copy, modify, merge, publish,
+** distribute, sublicense, and/or sell copies of the Materials, and to
+** permit persons to whom the Materials are furnished to do so, subject to
+** the following conditions:
+** The above copyright notice and this permission notice shall be included
+** in all copies or substantial portions of the Materials.
+#ifndef __glew_h__
+#define __glew_h__
+#define __GLEW_H__
+#if defined(__gl_h_) || defined(__GL_H__) || defined(_GL_H) || defined(__X_GL_H)
+#error gl.h included before glew.h
+#if defined(__gl2_h_)
+#error gl2.h included before glew.h
+#if defined(__gltypes_h_)
+#error gltypes.h included before glew.h
+#if defined(__REGAL_H__)
+#error Regal.h included before glew.h
+#if defined(__glext_h_) || defined(__GLEXT_H_)
+#error glext.h included before glew.h
+#if defined(__gl_ATI_h_)
+#error glATI.h included before glew.h
+#define __gl_h_
+#define __gl2_h_
+#define __GL_H__
+#define _GL_H
+#define __gltypes_h_
+#define __REGAL_H__
+#define __X_GL_H
+#define __glext_h_
+#define __GLEXT_H_
+#define __gl_ATI_h_
+#if defined(_WIN32)
+ * GLEW does not include <windows.h> to avoid name space pollution.
+ * GL needs GLAPI and GLAPIENTRY, GLU needs APIENTRY, CALLBACK, and wchar_t
+ * defined properly.
+ */
+/* <windef.h> and <gl.h>*/
+#ifdef APIENTRY
+# ifndef GLAPIENTRY
+# endif
+# endif
+# if defined(__MINGW32__) || defined(__CYGWIN__) || (_MSC_VER >= 800) || defined(_STDCALL_SUPPORTED) || defined(__BORLANDC__)
+# define APIENTRY __stdcall
+# ifndef GLAPIENTRY
+# define GLAPIENTRY __stdcall
+# endif
+# define GLEWAPIENTRY __stdcall
+# endif
+# else
+# define APIENTRY
+# endif
+#ifndef GLAPI
+# if defined(__MINGW32__) || defined(__CYGWIN__)
+# define GLAPI extern
+# endif
+/* <winnt.h> */
+#ifndef CALLBACK
+# if defined(__MINGW32__) || defined(__CYGWIN__)
+# define CALLBACK __attribute__ ((__stdcall__))
+# elif (defined(_M_MRX000) || defined(_M_IX86) || defined(_M_ALPHA) || defined(_M_PPC)) && !defined(MIDL_PASS)
+# define CALLBACK __stdcall
+# else
+# define CALLBACK
+# endif
+/* <wingdi.h> and <winnt.h> */
+#ifndef WINGDIAPI
+#define WINGDIAPI __declspec(dllimport)
+/* <ctype.h> */
+#if (defined(_MSC_VER) || defined(__BORLANDC__)) && !defined(_WCHAR_T_DEFINED)
+typedef unsigned short wchar_t;
+# define _WCHAR_T_DEFINED
+/* <stddef.h> */
+#if !defined(_W64)
+# if !defined(__midl) && (defined(_X86_) || defined(_M_IX86)) && defined(_MSC_VER) && _MSC_VER >= 1300
+# define _W64 __w64
+# else
+# define _W64
+# endif
+#if !defined(_PTRDIFF_T_DEFINED) && !defined(_PTRDIFF_T_) && !defined(__MINGW64__)
+# ifdef _WIN64
+typedef __int64 ptrdiff_t;
+# else
+typedef _W64 int ptrdiff_t;
+# endif
+# define _PTRDIFF_T_
+#ifndef GLAPI
+# if defined(__MINGW32__) || defined(__CYGWIN__)
+# define GLAPI extern
+# else
+# endif
+ * GLEW_STATIC is defined for static library.
+ * GLEW_BUILD is defined for building the DLL library.
+ */
+# define GLEWAPI extern
+# ifdef GLEW_BUILD
+# define GLEWAPI extern __declspec(dllexport)
+# else
+# define GLEWAPI extern __declspec(dllimport)
+# endif
+#else /* _UNIX */
+ * Needed for ptrdiff_t in turn needed by VBO. This is defined by ISO
+ * C. On my system, this amounts to _3 lines_ of included code, all of
+ * them pretty much harmless. If you know of a way of detecting 32 vs
+ * 64 _targets_ at compile time you are free to replace this with
+ * something that's portable. For now, _this_ is the portable solution.
+ * (mem, 2004-01-04)
+ */
+#include <stddef.h>
+/* SGI MIPSPro doesn't like stdint.h in C++ mode */
+/* ID: 3376260 Solaris 9 has inttypes.h, but not stdint.h */
+#if (defined(__sgi) || defined(__sun)) && !defined(__GNUC__)
+#include <inttypes.h>
+#include <stdint.h>
+#define APIENTRY
+ * GLEW_STATIC is defined for static library.
+ */
+# define GLEWAPI extern
+# if defined(__GNUC__) && __GNUC__>=4
+# define GLEWAPI extern __attribute__ ((visibility("default")))
+# elif defined(__SUNPRO_C) || defined(__SUNPRO_CC)
+# define GLEWAPI extern __global
+# else
+# define GLEWAPI extern
+# endif
+/* <glu.h> */
+#ifndef GLAPI
+#define GLAPI extern
+#endif /* _WIN32 */
+#ifdef __cplusplus
+extern "C" {
+/* ----------------------------- GL_VERSION_1_1 ---------------------------- */
+#ifndef GL_VERSION_1_1
+#define GL_VERSION_1_1 1
+typedef unsigned int GLenum;
+typedef unsigned int GLbitfield;
+typedef unsigned int GLuint;
+typedef int GLint;
+typedef int GLsizei;
+typedef unsigned char GLboolean;
+typedef signed char GLbyte;
+typedef short GLshort;
+typedef unsigned char GLubyte;
+typedef unsigned short GLushort;
+typedef unsigned long GLulong;
+typedef float GLfloat;
+typedef float GLclampf;
+typedef double GLdouble;
+typedef double GLclampd;
+typedef void GLvoid;
+#if defined(_MSC_VER) && _MSC_VER < 1400
+typedef __int64 GLint64EXT;
+typedef unsigned __int64 GLuint64EXT;
+#elif defined(_MSC_VER) || defined(__BORLANDC__)
+typedef signed long long GLint64EXT;
+typedef unsigned long long GLuint64EXT;
+# if defined(__MINGW32__) || defined(__CYGWIN__)
+#include <inttypes.h>
+# endif
+typedef int64_t GLint64EXT;
+typedef uint64_t GLuint64EXT;
+typedef GLint64EXT GLint64;
+typedef GLuint64EXT GLuint64;
+typedef struct __GLsync *GLsync;
+typedef char GLchar;
+#define GL_ZERO 0
+#define GL_FALSE 0
+#define GL_LOGIC_OP 0x0BF1
+#define GL_NONE 0
+#define GL_NO_ERROR 0
+#define GL_POINTS 0x0000
+#define GL_CURRENT_BIT 0x00000001
+#define GL_TRUE 1
+#define GL_ONE 1
+#define GL_CLIENT_PIXEL_STORE_BIT 0x00000001
+#define GL_LINES 0x0001
+#define GL_LINE_LOOP 0x0002
+#define GL_POINT_BIT 0x00000002
+#define GL_CLIENT_VERTEX_ARRAY_BIT 0x00000002
+#define GL_LINE_STRIP 0x0003
+#define GL_LINE_BIT 0x00000004
+#define GL_TRIANGLES 0x0004
+#define GL_TRIANGLE_STRIP 0x0005
+#define GL_TRIANGLE_FAN 0x0006
+#define GL_QUADS 0x0007
+#define GL_QUAD_STRIP 0x0008
+#define GL_POLYGON_BIT 0x00000008
+#define GL_POLYGON 0x0009
+#define GL_POLYGON_STIPPLE_BIT 0x00000010
+#define GL_PIXEL_MODE_BIT 0x00000020
+#define GL_LIGHTING_BIT 0x00000040
+#define GL_FOG_BIT 0x00000080
+#define GL_DEPTH_BUFFER_BIT 0x00000100
+#define GL_ACCUM 0x0100
+#define GL_LOAD 0x0101
+#define GL_RETURN 0x0102
+#define GL_MULT 0x0103
+#define GL_ADD 0x0104
+#define GL_NEVER 0x0200
+#define GL_ACCUM_BUFFER_BIT 0x00000200
+#define GL_LESS 0x0201
+#define GL_EQUAL 0x0202
+#define GL_LEQUAL 0x0203
+#define GL_GREATER 0x0204
+#define GL_NOTEQUAL 0x0205
+#define GL_GEQUAL 0x0206
+#define GL_ALWAYS 0x0207
+#define GL_SRC_COLOR 0x0300
+#define GL_ONE_MINUS_SRC_COLOR 0x0301
+#define GL_SRC_ALPHA 0x0302
+#define GL_ONE_MINUS_SRC_ALPHA 0x0303
+#define GL_DST_ALPHA 0x0304
+#define GL_ONE_MINUS_DST_ALPHA 0x0305
+#define GL_DST_COLOR 0x0306
+#define GL_ONE_MINUS_DST_COLOR 0x0307
+#define GL_SRC_ALPHA_SATURATE 0x0308
+#define GL_STENCIL_BUFFER_BIT 0x00000400
+#define GL_FRONT_LEFT 0x0400
+#define GL_FRONT_RIGHT 0x0401
+#define GL_BACK_LEFT 0x0402
+#define GL_BACK_RIGHT 0x0403
+#define GL_FRONT 0x0404
+#define GL_BACK 0x0405
+#define GL_LEFT 0x0406
+#define GL_RIGHT 0x0407
+#define GL_FRONT_AND_BACK 0x0408
+#define GL_AUX0 0x0409
+#define GL_AUX1 0x040A
+#define GL_AUX2 0x040B
+#define GL_AUX3 0x040C
+#define GL_INVALID_ENUM 0x0500
+#define GL_INVALID_VALUE 0x0501
+#define GL_INVALID_OPERATION 0x0502
+#define GL_STACK_OVERFLOW 0x0503
+#define GL_STACK_UNDERFLOW 0x0504
+#define GL_OUT_OF_MEMORY 0x0505
+#define GL_2D 0x0600
+#define GL_3D 0x0601
+#define GL_3D_COLOR 0x0602
+#define GL_3D_COLOR_TEXTURE 0x0603
+#define GL_4D_COLOR_TEXTURE 0x0604
+#define GL_PASS_THROUGH_TOKEN 0x0700
+#define GL_POINT_TOKEN 0x0701
+#define GL_LINE_TOKEN 0x0702
+#define GL_POLYGON_TOKEN 0x0703
+#define GL_BITMAP_TOKEN 0x0704
+#define GL_DRAW_PIXEL_TOKEN 0x0705
+#define GL_COPY_PIXEL_TOKEN 0x0706
+#define GL_LINE_RESET_TOKEN 0x0707
+#define GL_EXP 0x0800
+#define GL_VIEWPORT_BIT 0x00000800
+#define GL_EXP2 0x0801
+#define GL_CW 0x0900
+#define GL_CCW 0x0901
+#define GL_COEFF 0x0A00
+#define GL_ORDER 0x0A01
+#define GL_DOMAIN 0x0A02
+#define GL_CURRENT_COLOR 0x0B00
+#define GL_CURRENT_INDEX 0x0B01
+#define GL_CURRENT_NORMAL 0x0B02
+#define GL_POINT_SMOOTH 0x0B10
+#define GL_POINT_SIZE 0x0B11
+#define GL_POINT_SIZE_RANGE 0x0B12
+#define GL_LINE_SMOOTH 0x0B20
+#define GL_LINE_WIDTH 0x0B21
+#define GL_LINE_WIDTH_RANGE 0x0B22
+#define GL_LINE_STIPPLE 0x0B24
+#define GL_LIST_MODE 0x0B30
+#define GL_MAX_LIST_NESTING 0x0B31
+#define GL_LIST_BASE 0x0B32
+#define GL_LIST_INDEX 0x0B33
+#define GL_POLYGON_MODE 0x0B40
+#define GL_POLYGON_SMOOTH 0x0B41
+#define GL_POLYGON_STIPPLE 0x0B42
+#define GL_EDGE_FLAG 0x0B43
+#define GL_CULL_FACE 0x0B44
+#define GL_CULL_FACE_MODE 0x0B45
+#define GL_FRONT_FACE 0x0B46
+#define GL_LIGHTING 0x0B50
+#define GL_SHADE_MODEL 0x0B54
+#define GL_COLOR_MATERIAL 0x0B57
+#define GL_FOG 0x0B60
+#define GL_FOG_INDEX 0x0B61
+#define GL_FOG_DENSITY 0x0B62
+#define GL_FOG_START 0x0B63
+#define GL_FOG_END 0x0B64
+#define GL_FOG_MODE 0x0B65
+#define GL_FOG_COLOR 0x0B66
+#define GL_DEPTH_RANGE 0x0B70
+#define GL_DEPTH_TEST 0x0B71
+#define GL_DEPTH_WRITEMASK 0x0B72
+#define GL_DEPTH_CLEAR_VALUE 0x0B73
+#define GL_DEPTH_FUNC 0x0B74
+#define GL_ACCUM_CLEAR_VALUE 0x0B80
+#define GL_STENCIL_TEST 0x0B90
+#define GL_STENCIL_FUNC 0x0B92
+#define GL_STENCIL_FAIL 0x0B94
+#define GL_STENCIL_REF 0x0B97
+#define GL_MATRIX_MODE 0x0BA0
+#define GL_NORMALIZE 0x0BA1
+#define GL_VIEWPORT 0x0BA2
+#define GL_ALPHA_TEST 0x0BC0
+#define GL_ALPHA_TEST_FUNC 0x0BC1
+#define GL_ALPHA_TEST_REF 0x0BC2
+#define GL_DITHER 0x0BD0
+#define GL_BLEND_DST 0x0BE0
+#define GL_BLEND_SRC 0x0BE1
+#define GL_BLEND 0x0BE2
+#define GL_LOGIC_OP_MODE 0x0BF0
+#define GL_INDEX_LOGIC_OP 0x0BF1
+#define GL_COLOR_LOGIC_OP 0x0BF2
+#define GL_AUX_BUFFERS 0x0C00
+#define GL_DRAW_BUFFER 0x0C01
+#define GL_READ_BUFFER 0x0C02
+#define GL_SCISSOR_BOX 0x0C10
+#define GL_SCISSOR_TEST 0x0C11
+#define GL_INDEX_CLEAR_VALUE 0x0C20
+#define GL_INDEX_WRITEMASK 0x0C21
+#define GL_COLOR_CLEAR_VALUE 0x0C22
+#define GL_COLOR_WRITEMASK 0x0C23
+#define GL_INDEX_MODE 0x0C30
+#define GL_RGBA_MODE 0x0C31
+#define GL_DOUBLEBUFFER 0x0C32
+#define GL_STEREO 0x0C33
+#define GL_RENDER_MODE 0x0C40
+#define GL_POINT_SMOOTH_HINT 0x0C51
+#define GL_LINE_SMOOTH_HINT 0x0C52
+#define GL_FOG_HINT 0x0C54
+#define GL_TEXTURE_GEN_S 0x0C60
+#define GL_TEXTURE_GEN_T 0x0C61
+#define GL_TEXTURE_GEN_R 0x0C62
+#define GL_TEXTURE_GEN_Q 0x0C63
+#define GL_PIXEL_MAP_I_TO_I 0x0C70
+#define GL_PIXEL_MAP_S_TO_S 0x0C71
+#define GL_PIXEL_MAP_I_TO_R 0x0C72
+#define GL_PIXEL_MAP_I_TO_G 0x0C73
+#define GL_PIXEL_MAP_I_TO_B 0x0C74
+#define GL_PIXEL_MAP_I_TO_A 0x0C75
+#define GL_PIXEL_MAP_R_TO_R 0x0C76
+#define GL_PIXEL_MAP_G_TO_G 0x0C77
+#define GL_PIXEL_MAP_B_TO_B 0x0C78
+#define GL_PIXEL_MAP_A_TO_A 0x0C79
+#define GL_PIXEL_MAP_I_TO_I_SIZE 0x0CB0
+#define GL_PIXEL_MAP_S_TO_S_SIZE 0x0CB1
+#define GL_PIXEL_MAP_I_TO_R_SIZE 0x0CB2
+#define GL_PIXEL_MAP_I_TO_G_SIZE 0x0CB3
+#define GL_PIXEL_MAP_I_TO_B_SIZE 0x0CB4
+#define GL_PIXEL_MAP_I_TO_A_SIZE 0x0CB5
+#define GL_PIXEL_MAP_R_TO_R_SIZE 0x0CB6
+#define GL_PIXEL_MAP_G_TO_G_SIZE 0x0CB7
+#define GL_PIXEL_MAP_B_TO_B_SIZE 0x0CB8
+#define GL_PIXEL_MAP_A_TO_A_SIZE 0x0CB9
+#define GL_PACK_SWAP_BYTES 0x0D00
+#define GL_PACK_LSB_FIRST 0x0D01
+#define GL_PACK_ROW_LENGTH 0x0D02
+#define GL_PACK_SKIP_ROWS 0x0D03
+#define GL_PACK_SKIP_PIXELS 0x0D04
+#define GL_PACK_ALIGNMENT 0x0D05
+#define GL_MAP_COLOR 0x0D10
+#define GL_MAP_STENCIL 0x0D11
+#define GL_INDEX_SHIFT 0x0D12
+#define GL_INDEX_OFFSET 0x0D13
+#define GL_RED_SCALE 0x0D14
+#define GL_RED_BIAS 0x0D15
+#define GL_ZOOM_X 0x0D16
+#define GL_ZOOM_Y 0x0D17
+#define GL_GREEN_SCALE 0x0D18
+#define GL_GREEN_BIAS 0x0D19
+#define GL_BLUE_SCALE 0x0D1A
+#define GL_BLUE_BIAS 0x0D1B
+#define GL_ALPHA_SCALE 0x0D1C
+#define GL_ALPHA_BIAS 0x0D1D
+#define GL_DEPTH_SCALE 0x0D1E
+#define GL_DEPTH_BIAS 0x0D1F
+#define GL_MAX_EVAL_ORDER 0x0D30
+#define GL_MAX_LIGHTS 0x0D31
+#define GL_MAX_CLIP_PLANES 0x0D32
+#define GL_MAX_TEXTURE_SIZE 0x0D33
+#define GL_MAX_PIXEL_MAP_TABLE 0x0D34
+#define GL_SUBPIXEL_BITS 0x0D50
+#define GL_INDEX_BITS 0x0D51
+#define GL_RED_BITS 0x0D52
+#define GL_GREEN_BITS 0x0D53
+#define GL_BLUE_BITS 0x0D54
+#define GL_ALPHA_BITS 0x0D55
+#define GL_DEPTH_BITS 0x0D56
+#define GL_STENCIL_BITS 0x0D57
+#define GL_ACCUM_RED_BITS 0x0D58
+#define GL_ACCUM_GREEN_BITS 0x0D59
+#define GL_ACCUM_BLUE_BITS 0x0D5A
+#define GL_NAME_STACK_DEPTH 0x0D70
+#define GL_AUTO_NORMAL 0x0D80
+#define GL_MAP1_COLOR_4 0x0D90
+#define GL_MAP1_INDEX 0x0D91
+#define GL_MAP1_NORMAL 0x0D92
+#define GL_MAP1_TEXTURE_COORD_1 0x0D93
+#define GL_MAP1_TEXTURE_COORD_2 0x0D94
+#define GL_MAP1_TEXTURE_COORD_3 0x0D95
+#define GL_MAP1_TEXTURE_COORD_4 0x0D96
+#define GL_MAP1_VERTEX_3 0x0D97
+#define GL_MAP1_VERTEX_4 0x0D98
+#define GL_MAP2_COLOR_4 0x0DB0
+#define GL_MAP2_INDEX 0x0DB1
+#define GL_MAP2_NORMAL 0x0DB2
+#define GL_MAP2_TEXTURE_COORD_1 0x0DB3
+#define GL_MAP2_TEXTURE_COORD_2 0x0DB4
+#define GL_MAP2_TEXTURE_COORD_3 0x0DB5
+#define GL_MAP2_TEXTURE_COORD_4 0x0DB6
+#define GL_MAP2_VERTEX_3 0x0DB7
+#define GL_MAP2_VERTEX_4 0x0DB8
+#define GL_MAP1_GRID_DOMAIN 0x0DD0
+#define GL_MAP2_GRID_DOMAIN 0x0DD2
+#define GL_TEXTURE_1D 0x0DE0
+#define GL_TEXTURE_2D 0x0DE1
+#define GL_TEXTURE_WIDTH 0x1000
+#define GL_TRANSFORM_BIT 0x00001000
+#define GL_TEXTURE_HEIGHT 0x1001
+#define GL_TEXTURE_BORDER 0x1005
+#define GL_DONT_CARE 0x1100
+#define GL_FASTEST 0x1101
+#define GL_NICEST 0x1102
+#define GL_AMBIENT 0x1200
+#define GL_DIFFUSE 0x1201
+#define GL_SPECULAR 0x1202
+#define GL_POSITION 0x1203
+#define GL_SPOT_DIRECTION 0x1204
+#define GL_SPOT_EXPONENT 0x1205
+#define GL_SPOT_CUTOFF 0x1206
+#define GL_COMPILE 0x1300
+#define GL_COMPILE_AND_EXECUTE 0x1301
+#define GL_BYTE 0x1400
+#define GL_UNSIGNED_BYTE 0x1401
+#define GL_SHORT 0x1402
+#define GL_UNSIGNED_SHORT 0x1403
+#define GL_INT 0x1404
+#define GL_UNSIGNED_INT 0x1405
+#define GL_FLOAT 0x1406
+#define GL_2_BYTES 0x1407
+#define GL_3_BYTES 0x1408
+#define GL_4_BYTES 0x1409
+#define GL_DOUBLE 0x140A
+#define GL_CLEAR 0x1500
+#define GL_AND 0x1501
+#define GL_AND_REVERSE 0x1502
+#define GL_COPY 0x1503
+#define GL_AND_INVERTED 0x1504
+#define GL_NOOP 0x1505
+#define GL_XOR 0x1506
+#define GL_OR 0x1507
+#define GL_NOR 0x1508
+#define GL_EQUIV 0x1509
+#define GL_INVERT 0x150A
+#define GL_OR_REVERSE 0x150B
+#define GL_COPY_INVERTED 0x150C
+#define GL_OR_INVERTED 0x150D
+#define GL_NAND 0x150E
+#define GL_SET 0x150F
+#define GL_EMISSION 0x1600
+#define GL_SHININESS 0x1601
+#define GL_AMBIENT_AND_DIFFUSE 0x1602
+#define GL_COLOR_INDEXES 0x1603
+#define GL_MODELVIEW 0x1700
+#define GL_PROJECTION 0x1701
+#define GL_TEXTURE 0x1702
+#define GL_COLOR 0x1800
+#define GL_DEPTH 0x1801
+#define GL_STENCIL 0x1802
+#define GL_COLOR_INDEX 0x1900
+#define GL_STENCIL_INDEX 0x1901
+#define GL_DEPTH_COMPONENT 0x1902
+#define GL_RED 0x1903
+#define GL_GREEN 0x1904
+#define GL_BLUE 0x1905
+#define GL_ALPHA 0x1906
+#define GL_RGB 0x1907
+#define GL_RGBA 0x1908
+#define GL_LUMINANCE 0x1909
+#define GL_LUMINANCE_ALPHA 0x190A
+#define GL_BITMAP 0x1A00
+#define GL_POINT 0x1B00
+#define GL_LINE 0x1B01
+#define GL_FILL 0x1B02
+#define GL_RENDER 0x1C00
+#define GL_FEEDBACK 0x1C01
+#define GL_SELECT 0x1C02
+#define GL_FLAT 0x1D00
+#define GL_SMOOTH 0x1D01
+#define GL_KEEP 0x1E00
+#define GL_REPLACE 0x1E01
+#define GL_INCR 0x1E02
+#define GL_DECR 0x1E03
+#define GL_VENDOR 0x1F00
+#define GL_RENDERER 0x1F01
+#define GL_VERSION 0x1F02
+#define GL_EXTENSIONS 0x1F03
+#define GL_S 0x2000
+#define GL_ENABLE_BIT 0x00002000
+#define GL_T 0x2001
+#define GL_R 0x2002
+#define GL_Q 0x2003
+#define GL_MODULATE 0x2100
+#define GL_DECAL 0x2101
+#define GL_TEXTURE_ENV_MODE 0x2200
+#define GL_TEXTURE_ENV_COLOR 0x2201
+#define GL_TEXTURE_ENV 0x2300
+#define GL_EYE_LINEAR 0x2400
+#define GL_OBJECT_LINEAR 0x2401
+#define GL_SPHERE_MAP 0x2402
+#define GL_TEXTURE_GEN_MODE 0x2500
+#define GL_OBJECT_PLANE 0x2501
+#define GL_EYE_PLANE 0x2502
+#define GL_NEAREST 0x2600
+#define GL_LINEAR 0x2601
+#define GL_TEXTURE_MAG_FILTER 0x2800
+#define GL_TEXTURE_MIN_FILTER 0x2801
+#define GL_TEXTURE_WRAP_S 0x2802
+#define GL_TEXTURE_WRAP_T 0x2803
+#define GL_CLAMP 0x2900
+#define GL_REPEAT 0x2901
+#define GL_R3_G3_B2 0x2A10
+#define GL_V2F 0x2A20
+#define GL_V3F 0x2A21
+#define GL_C4UB_V2F 0x2A22
+#define GL_C4UB_V3F 0x2A23
+#define GL_C3F_V3F 0x2A24
+#define GL_N3F_V3F 0x2A25
+#define GL_C4F_N3F_V3F 0x2A26
+#define GL_T2F_V3F 0x2A27
+#define GL_T4F_V4F 0x2A28
+#define GL_T2F_C4UB_V3F 0x2A29
+#define GL_T2F_C3F_V3F 0x2A2A
+#define GL_T2F_N3F_V3F 0x2A2B
+#define GL_T2F_C4F_N3F_V3F 0x2A2C
+#define GL_T4F_C4F_N3F_V4F 0x2A2D
+#define GL_CLIP_PLANE0 0x3000
+#define GL_CLIP_PLANE1 0x3001
+#define GL_CLIP_PLANE2 0x3002
+#define GL_CLIP_PLANE3 0x3003
+#define GL_CLIP_PLANE4 0x3004
+#define GL_CLIP_PLANE5 0x3005
+#define GL_LIGHT0 0x4000
+#define GL_COLOR_BUFFER_BIT 0x00004000
+#define GL_LIGHT1 0x4001
+#define GL_LIGHT2 0x4002
+#define GL_LIGHT3 0x4003
+#define GL_LIGHT4 0x4004
+#define GL_LIGHT5 0x4005
+#define GL_LIGHT6 0x4006
+#define GL_LIGHT7 0x4007
+#define GL_HINT_BIT 0x00008000
+#define GL_POLYGON_OFFSET_FILL 0x8037
+#define GL_ALPHA4 0x803B
+#define GL_ALPHA8 0x803C
+#define GL_ALPHA12 0x803D
+#define GL_ALPHA16 0x803E
+#define GL_LUMINANCE4 0x803F
+#define GL_LUMINANCE8 0x8040
+#define GL_LUMINANCE12 0x8041
+#define GL_LUMINANCE16 0x8042
+#define GL_LUMINANCE4_ALPHA4 0x8043
+#define GL_LUMINANCE6_ALPHA2 0x8044
+#define GL_LUMINANCE8_ALPHA8 0x8045
+#define GL_LUMINANCE12_ALPHA4 0x8046
+#define GL_LUMINANCE12_ALPHA12 0x8047
+#define GL_LUMINANCE16_ALPHA16 0x8048
+#define GL_INTENSITY 0x8049
+#define GL_INTENSITY4 0x804A
+#define GL_INTENSITY8 0x804B
+#define GL_INTENSITY12 0x804C
+#define GL_INTENSITY16 0x804D
+#define GL_RGB4 0x804F
+#define GL_RGB5 0x8050
+#define GL_RGB8 0x8051
+#define GL_RGB10 0x8052
+#define GL_RGB12 0x8053
+#define GL_RGB16 0x8054
+#define GL_RGBA2 0x8055
+#define GL_RGBA4 0x8056
+#define GL_RGB5_A1 0x8057
+#define GL_RGBA8 0x8058
+#define GL_RGB10_A2 0x8059
+#define GL_RGBA12 0x805A
+#define GL_RGBA16 0x805B
+#define GL_TEXTURE_RED_SIZE 0x805C
+#define GL_TEXTURE_BLUE_SIZE 0x805E
+#define GL_PROXY_TEXTURE_1D 0x8063
+#define GL_PROXY_TEXTURE_2D 0x8064
+#define GL_TEXTURE_PRIORITY 0x8066
+#define GL_TEXTURE_RESIDENT 0x8067
+#define GL_TEXTURE_BINDING_1D 0x8068
+#define GL_TEXTURE_BINDING_2D 0x8069
+#define GL_VERTEX_ARRAY 0x8074
+#define GL_NORMAL_ARRAY 0x8075
+#define GL_COLOR_ARRAY 0x8076
+#define GL_INDEX_ARRAY 0x8077
+#define GL_TEXTURE_COORD_ARRAY 0x8078
+#define GL_EDGE_FLAG_ARRAY 0x8079
+#define GL_VERTEX_ARRAY_SIZE 0x807A
+#define GL_VERTEX_ARRAY_TYPE 0x807B
+#define GL_NORMAL_ARRAY_TYPE 0x807E
+#define GL_COLOR_ARRAY_SIZE 0x8081
+#define GL_COLOR_ARRAY_TYPE 0x8082
+#define GL_COLOR_ARRAY_STRIDE 0x8083
+#define GL_INDEX_ARRAY_TYPE 0x8085
+#define GL_INDEX_ARRAY_STRIDE 0x8086
+#define GL_COLOR_ARRAY_POINTER 0x8090
+#define GL_INDEX_ARRAY_POINTER 0x8091
+#define GL_COLOR_INDEX1_EXT 0x80E2
+#define GL_COLOR_INDEX2_EXT 0x80E3
+#define GL_COLOR_INDEX4_EXT 0x80E4
+#define GL_COLOR_INDEX8_EXT 0x80E5
+#define GL_COLOR_INDEX12_EXT 0x80E6
+#define GL_COLOR_INDEX16_EXT 0x80E7
+#define GL_EVAL_BIT 0x00010000
+#define GL_LIST_BIT 0x00020000
+#define GL_TEXTURE_BIT 0x00040000
+#define GL_SCISSOR_BIT 0x00080000
+#define GL_ALL_ATTRIB_BITS 0x000fffff
+#define GL_CLIENT_ALL_ATTRIB_BITS 0xffffffff
+GLAPI void GLAPIENTRY glAccum (GLenum op, GLfloat value);
+GLAPI void GLAPIENTRY glAlphaFunc (GLenum func, GLclampf ref);
+GLAPI GLboolean GLAPIENTRY glAreTexturesResident (GLsizei n, const GLuint *textures, GLboolean *residences);
+GLAPI void GLAPIENTRY glArrayElement (GLint i);
+GLAPI void GLAPIENTRY glBegin (GLenum mode);
+GLAPI void GLAPIENTRY glBindTexture (GLenum target, GLuint texture);
+GLAPI void GLAPIENTRY glBitmap (GLsizei width, GLsizei height, GLfloat xorig, GLfloat yorig, GLfloat xmove, GLfloat ymove, const GLubyte *bitmap);
+GLAPI void GLAPIENTRY glBlendFunc (GLenum sfactor, GLenum dfactor);
+GLAPI void GLAPIENTRY glCallList (GLuint list);
+GLAPI void GLAPIENTRY glCallLists (GLsizei n, GLenum type, const void *lists);
+GLAPI void GLAPIENTRY glClear (GLbitfield mask);
+GLAPI void GLAPIENTRY glClearAccum (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha);
+GLAPI void GLAPIENTRY glClearColor (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
+GLAPI void GLAPIENTRY glClearDepth (GLclampd depth);
+GLAPI void GLAPIENTRY glClearIndex (GLfloat c);
+GLAPI void GLAPIENTRY glClearStencil (GLint s);
+GLAPI void GLAPIENTRY glClipPlane (GLenum plane, const GLdouble *equation);
+GLAPI void GLAPIENTRY glColor3b (GLbyte red, GLbyte green, GLbyte blue);
+GLAPI void GLAPIENTRY glColor3bv (const GLbyte *v);
+GLAPI void GLAPIENTRY glColor3d (GLdouble red, GLdouble green, GLdouble blue);
+GLAPI void GLAPIENTRY glColor3dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glColor3f (GLfloat red, GLfloat green, GLfloat blue);
+GLAPI void GLAPIENTRY glColor3fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glColor3i (GLint red, GLint green, GLint blue);
+GLAPI void GLAPIENTRY glColor3iv (const GLint *v);
+GLAPI void GLAPIENTRY glColor3s (GLshort red, GLshort green, GLshort blue);
+GLAPI void GLAPIENTRY glColor3sv (const GLshort *v);
+GLAPI void GLAPIENTRY glColor3ub (GLubyte red, GLubyte green, GLubyte blue);
+GLAPI void GLAPIENTRY glColor3ubv (const GLubyte *v);
+GLAPI void GLAPIENTRY glColor3ui (GLuint red, GLuint green, GLuint blue);
+GLAPI void GLAPIENTRY glColor3uiv (const GLuint *v);
+GLAPI void GLAPIENTRY glColor3us (GLushort red, GLushort green, GLushort blue);
+GLAPI void GLAPIENTRY glColor3usv (const GLushort *v);
+GLAPI void GLAPIENTRY glColor4b (GLbyte red, GLbyte green, GLbyte blue, GLbyte alpha);
+GLAPI void GLAPIENTRY glColor4bv (const GLbyte *v);
+GLAPI void GLAPIENTRY glColor4d (GLdouble red, GLdouble green, GLdouble blue, GLdouble alpha);
+GLAPI void GLAPIENTRY glColor4dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glColor4f (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha);
+GLAPI void GLAPIENTRY glColor4fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glColor4i (GLint red, GLint green, GLint blue, GLint alpha);
+GLAPI void GLAPIENTRY glColor4iv (const GLint *v);
+GLAPI void GLAPIENTRY glColor4s (GLshort red, GLshort green, GLshort blue, GLshort alpha);
+GLAPI void GLAPIENTRY glColor4sv (const GLshort *v);
+GLAPI void GLAPIENTRY glColor4ub (GLubyte red, GLubyte green, GLubyte blue, GLubyte alpha);
+GLAPI void GLAPIENTRY glColor4ubv (const GLubyte *v);
+GLAPI void GLAPIENTRY glColor4ui (GLuint red, GLuint green, GLuint blue, GLuint alpha);
+GLAPI void GLAPIENTRY glColor4uiv (const GLuint *v);
+GLAPI void GLAPIENTRY glColor4us (GLushort red, GLushort green, GLushort blue, GLushort alpha);
+GLAPI void GLAPIENTRY glColor4usv (const GLushort *v);
+GLAPI void GLAPIENTRY glColorMask (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha);
+GLAPI void GLAPIENTRY glColorMaterial (GLenum face, GLenum mode);
+GLAPI void GLAPIENTRY glColorPointer (GLint size, GLenum type, GLsizei stride, const void *pointer);
+GLAPI void GLAPIENTRY glCopyPixels (GLint x, GLint y, GLsizei width, GLsizei height, GLenum type);
+GLAPI void GLAPIENTRY glCopyTexImage1D (GLenum target, GLint level, GLenum internalFormat, GLint x, GLint y, GLsizei width, GLint border);
+GLAPI void GLAPIENTRY glCopyTexImage2D (GLenum target, GLint level, GLenum internalFormat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border);
+GLAPI void GLAPIENTRY glCopyTexSubImage1D (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width);
+GLAPI void GLAPIENTRY glCopyTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+GLAPI void GLAPIENTRY glCullFace (GLenum mode);
+GLAPI void GLAPIENTRY glDeleteLists (GLuint list, GLsizei range);
+GLAPI void GLAPIENTRY glDeleteTextures (GLsizei n, const GLuint *textures);
+GLAPI void GLAPIENTRY glDepthFunc (GLenum func);
+GLAPI void GLAPIENTRY glDepthMask (GLboolean flag);
+GLAPI void GLAPIENTRY glDepthRange (GLclampd zNear, GLclampd zFar);
+GLAPI void GLAPIENTRY glDisable (GLenum cap);
+GLAPI void GLAPIENTRY glDisableClientState (GLenum array);
+GLAPI void GLAPIENTRY glDrawArrays (GLenum mode, GLint first, GLsizei count);
+GLAPI void GLAPIENTRY glDrawBuffer (GLenum mode);
+GLAPI void GLAPIENTRY glDrawElements (GLenum mode, GLsizei count, GLenum type, const void *indices);
+GLAPI void GLAPIENTRY glDrawPixels (GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels);
+GLAPI void GLAPIENTRY glEdgeFlag (GLboolean flag);
+GLAPI void GLAPIENTRY glEdgeFlagPointer (GLsizei stride, const void *pointer);
+GLAPI void GLAPIENTRY glEdgeFlagv (const GLboolean *flag);
+GLAPI void GLAPIENTRY glEnable (GLenum cap);
+GLAPI void GLAPIENTRY glEnableClientState (GLenum array);
+GLAPI void GLAPIENTRY glEnd (void);
+GLAPI void GLAPIENTRY glEndList (void);
+GLAPI void GLAPIENTRY glEvalCoord1d (GLdouble u);
+GLAPI void GLAPIENTRY glEvalCoord1dv (const GLdouble *u);
+GLAPI void GLAPIENTRY glEvalCoord1f (GLfloat u);
+GLAPI void GLAPIENTRY glEvalCoord1fv (const GLfloat *u);
+GLAPI void GLAPIENTRY glEvalCoord2d (GLdouble u, GLdouble v);
+GLAPI void GLAPIENTRY glEvalCoord2dv (const GLdouble *u);
+GLAPI void GLAPIENTRY glEvalCoord2f (GLfloat u, GLfloat v);
+GLAPI void GLAPIENTRY glEvalCoord2fv (const GLfloat *u);
+GLAPI void GLAPIENTRY glEvalMesh1 (GLenum mode, GLint i1, GLint i2);
+GLAPI void GLAPIENTRY glEvalMesh2 (GLenum mode, GLint i1, GLint i2, GLint j1, GLint j2);
+GLAPI void GLAPIENTRY glEvalPoint1 (GLint i);
+GLAPI void GLAPIENTRY glEvalPoint2 (GLint i, GLint j);
+GLAPI void GLAPIENTRY glFeedbackBuffer (GLsizei size, GLenum type, GLfloat *buffer);
+GLAPI void GLAPIENTRY glFinish (void);
+GLAPI void GLAPIENTRY glFlush (void);
+GLAPI void GLAPIENTRY glFogf (GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glFogfv (GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glFogi (GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glFogiv (GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glFrontFace (GLenum mode);
+GLAPI void GLAPIENTRY glFrustum (GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar);
+GLAPI GLuint GLAPIENTRY glGenLists (GLsizei range);
+GLAPI void GLAPIENTRY glGenTextures (GLsizei n, GLuint *textures);
+GLAPI void GLAPIENTRY glGetBooleanv (GLenum pname, GLboolean *params);
+GLAPI void GLAPIENTRY glGetClipPlane (GLenum plane, GLdouble *equation);
+GLAPI void GLAPIENTRY glGetDoublev (GLenum pname, GLdouble *params);
+GLAPI GLenum GLAPIENTRY glGetError (void);
+GLAPI void GLAPIENTRY glGetFloatv (GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetIntegerv (GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetLightfv (GLenum light, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetLightiv (GLenum light, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetMapdv (GLenum target, GLenum query, GLdouble *v);
+GLAPI void GLAPIENTRY glGetMapfv (GLenum target, GLenum query, GLfloat *v);
+GLAPI void GLAPIENTRY glGetMapiv (GLenum target, GLenum query, GLint *v);
+GLAPI void GLAPIENTRY glGetMaterialfv (GLenum face, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetMaterialiv (GLenum face, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetPixelMapfv (GLenum map, GLfloat *values);
+GLAPI void GLAPIENTRY glGetPixelMapuiv (GLenum map, GLuint *values);
+GLAPI void GLAPIENTRY glGetPixelMapusv (GLenum map, GLushort *values);
+GLAPI void GLAPIENTRY glGetPointerv (GLenum pname, void* *params);
+GLAPI void GLAPIENTRY glGetPolygonStipple (GLubyte *mask);
+GLAPI const GLubyte * GLAPIENTRY glGetString (GLenum name);
+GLAPI void GLAPIENTRY glGetTexEnvfv (GLenum target, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetTexEnviv (GLenum target, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetTexGendv (GLenum coord, GLenum pname, GLdouble *params);
+GLAPI void GLAPIENTRY glGetTexGenfv (GLenum coord, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetTexGeniv (GLenum coord, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetTexImage (GLenum target, GLint level, GLenum format, GLenum type, void *pixels);
+GLAPI void GLAPIENTRY glGetTexLevelParameterfv (GLenum target, GLint level, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetTexLevelParameteriv (GLenum target, GLint level, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetTexParameterfv (GLenum target, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetTexParameteriv (GLenum target, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glHint (GLenum target, GLenum mode);
+GLAPI void GLAPIENTRY glIndexMask (GLuint mask);
+GLAPI void GLAPIENTRY glIndexPointer (GLenum type, GLsizei stride, const void *pointer);
+GLAPI void GLAPIENTRY glIndexd (GLdouble c);
+GLAPI void GLAPIENTRY glIndexdv (const GLdouble *c);
+GLAPI void GLAPIENTRY glIndexf (GLfloat c);
+GLAPI void GLAPIENTRY glIndexfv (const GLfloat *c);
+GLAPI void GLAPIENTRY glIndexi (GLint c);
+GLAPI void GLAPIENTRY glIndexiv (const GLint *c);
+GLAPI void GLAPIENTRY glIndexs (GLshort c);
+GLAPI void GLAPIENTRY glIndexsv (const GLshort *c);
+GLAPI void GLAPIENTRY glIndexub (GLubyte c);
+GLAPI void GLAPIENTRY glIndexubv (const GLubyte *c);
+GLAPI void GLAPIENTRY glInitNames (void);
+GLAPI void GLAPIENTRY glInterleavedArrays (GLenum format, GLsizei stride, const void *pointer);
+GLAPI GLboolean GLAPIENTRY glIsEnabled (GLenum cap);
+GLAPI GLboolean GLAPIENTRY glIsList (GLuint list);
+GLAPI GLboolean GLAPIENTRY glIsTexture (GLuint texture);
+GLAPI void GLAPIENTRY glLightModelf (GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glLightModelfv (GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glLightModeli (GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glLightModeliv (GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glLightf (GLenum light, GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glLightfv (GLenum light, GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glLighti (GLenum light, GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glLightiv (GLenum light, GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glLineStipple (GLint factor, GLushort pattern);
+GLAPI void GLAPIENTRY glLineWidth (GLfloat width);
+GLAPI void GLAPIENTRY glListBase (GLuint base);
+GLAPI void GLAPIENTRY glLoadIdentity (void);
+GLAPI void GLAPIENTRY glLoadMatrixd (const GLdouble *m);
+GLAPI void GLAPIENTRY glLoadMatrixf (const GLfloat *m);
+GLAPI void GLAPIENTRY glLoadName (GLuint name);
+GLAPI void GLAPIENTRY glLogicOp (GLenum opcode);
+GLAPI void GLAPIENTRY glMap1d (GLenum target, GLdouble u1, GLdouble u2, GLint stride, GLint order, const GLdouble *points);
+GLAPI void GLAPIENTRY glMap1f (GLenum target, GLfloat u1, GLfloat u2, GLint stride, GLint order, const GLfloat *points);
+GLAPI void GLAPIENTRY glMap2d (GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, const GLdouble *points);
+GLAPI void GLAPIENTRY glMap2f (GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, const GLfloat *points);
+GLAPI void GLAPIENTRY glMapGrid1d (GLint un, GLdouble u1, GLdouble u2);
+GLAPI void GLAPIENTRY glMapGrid1f (GLint un, GLfloat u1, GLfloat u2);
+GLAPI void GLAPIENTRY glMapGrid2d (GLint un, GLdouble u1, GLdouble u2, GLint vn, GLdouble v1, GLdouble v2);
+GLAPI void GLAPIENTRY glMapGrid2f (GLint un, GLfloat u1, GLfloat u2, GLint vn, GLfloat v1, GLfloat v2);
+GLAPI void GLAPIENTRY glMaterialf (GLenum face, GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glMaterialfv (GLenum face, GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glMateriali (GLenum face, GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glMaterialiv (GLenum face, GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glMatrixMode (GLenum mode);
+GLAPI void GLAPIENTRY glMultMatrixd (const GLdouble *m);
+GLAPI void GLAPIENTRY glMultMatrixf (const GLfloat *m);
+GLAPI void GLAPIENTRY glNewList (GLuint list, GLenum mode);
+GLAPI void GLAPIENTRY glNormal3b (GLbyte nx, GLbyte ny, GLbyte nz);
+GLAPI void GLAPIENTRY glNormal3bv (const GLbyte *v);
+GLAPI void GLAPIENTRY glNormal3d (GLdouble nx, GLdouble ny, GLdouble nz);
+GLAPI void GLAPIENTRY glNormal3dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glNormal3f (GLfloat nx, GLfloat ny, GLfloat nz);
+GLAPI void GLAPIENTRY glNormal3fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glNormal3i (GLint nx, GLint ny, GLint nz);
+GLAPI void GLAPIENTRY glNormal3iv (const GLint *v);
+GLAPI void GLAPIENTRY glNormal3s (GLshort nx, GLshort ny, GLshort nz);
+GLAPI void GLAPIENTRY glNormal3sv (const GLshort *v);
+GLAPI void GLAPIENTRY glNormalPointer (GLenum type, GLsizei stride, const void *pointer);
+GLAPI void GLAPIENTRY glOrtho (GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar);
+GLAPI void GLAPIENTRY glPassThrough (GLfloat token);
+GLAPI void GLAPIENTRY glPixelMapfv (GLenum map, GLsizei mapsize, const GLfloat *values);
+GLAPI void GLAPIENTRY glPixelMapuiv (GLenum map, GLsizei mapsize, const GLuint *values);
+GLAPI void GLAPIENTRY glPixelMapusv (GLenum map, GLsizei mapsize, const GLushort *values);
+GLAPI void GLAPIENTRY glPixelStoref (GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glPixelStorei (GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glPixelTransferf (GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glPixelTransferi (GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glPixelZoom (GLfloat xfactor, GLfloat yfactor);
+GLAPI void GLAPIENTRY glPointSize (GLfloat size);
+GLAPI void GLAPIENTRY glPolygonMode (GLenum face, GLenum mode);
+GLAPI void GLAPIENTRY glPolygonOffset (GLfloat factor, GLfloat units);
+GLAPI void GLAPIENTRY glPolygonStipple (const GLubyte *mask);
+GLAPI void GLAPIENTRY glPopAttrib (void);
+GLAPI void GLAPIENTRY glPopClientAttrib (void);
+GLAPI void GLAPIENTRY glPopMatrix (void);
+GLAPI void GLAPIENTRY glPopName (void);
+GLAPI void GLAPIENTRY glPrioritizeTextures (GLsizei n, const GLuint *textures, const GLclampf *priorities);
+GLAPI void GLAPIENTRY glPushAttrib (GLbitfield mask);
+GLAPI void GLAPIENTRY glPushClientAttrib (GLbitfield mask);
+GLAPI void GLAPIENTRY glPushMatrix (void);
+GLAPI void GLAPIENTRY glPushName (GLuint name);
+GLAPI void GLAPIENTRY glRasterPos2d (GLdouble x, GLdouble y);
+GLAPI void GLAPIENTRY glRasterPos2dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glRasterPos2f (GLfloat x, GLfloat y);
+GLAPI void GLAPIENTRY glRasterPos2fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glRasterPos2i (GLint x, GLint y);
+GLAPI void GLAPIENTRY glRasterPos2iv (const GLint *v);
+GLAPI void GLAPIENTRY glRasterPos2s (GLshort x, GLshort y);
+GLAPI void GLAPIENTRY glRasterPos2sv (const GLshort *v);
+GLAPI void GLAPIENTRY glRasterPos3d (GLdouble x, GLdouble y, GLdouble z);
+GLAPI void GLAPIENTRY glRasterPos3dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glRasterPos3f (GLfloat x, GLfloat y, GLfloat z);
+GLAPI void GLAPIENTRY glRasterPos3fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glRasterPos3i (GLint x, GLint y, GLint z);
+GLAPI void GLAPIENTRY glRasterPos3iv (const GLint *v);
+GLAPI void GLAPIENTRY glRasterPos3s (GLshort x, GLshort y, GLshort z);
+GLAPI void GLAPIENTRY glRasterPos3sv (const GLshort *v);
+GLAPI void GLAPIENTRY glRasterPos4d (GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+GLAPI void GLAPIENTRY glRasterPos4dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glRasterPos4f (GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+GLAPI void GLAPIENTRY glRasterPos4fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glRasterPos4i (GLint x, GLint y, GLint z, GLint w);
+GLAPI void GLAPIENTRY glRasterPos4iv (const GLint *v);
+GLAPI void GLAPIENTRY glRasterPos4s (GLshort x, GLshort y, GLshort z, GLshort w);
+GLAPI void GLAPIENTRY glRasterPos4sv (const GLshort *v);
+GLAPI void GLAPIENTRY glReadBuffer (GLenum mode);
+GLAPI void GLAPIENTRY glReadPixels (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, void *pixels);
+GLAPI void GLAPIENTRY glRectd (GLdouble x1, GLdouble y1, GLdouble x2, GLdouble y2);
+GLAPI void GLAPIENTRY glRectdv (const GLdouble *v1, const GLdouble *v2);
+GLAPI void GLAPIENTRY glRectf (GLfloat x1, GLfloat y1, GLfloat x2, GLfloat y2);
+GLAPI void GLAPIENTRY glRectfv (const GLfloat *v1, const GLfloat *v2);
+GLAPI void GLAPIENTRY glRecti (GLint x1, GLint y1, GLint x2, GLint y2);
+GLAPI void GLAPIENTRY glRectiv (const GLint *v1, const GLint *v2);
+GLAPI void GLAPIENTRY glRects (GLshort x1, GLshort y1, GLshort x2, GLshort y2);
+GLAPI void GLAPIENTRY glRectsv (const GLshort *v1, const GLshort *v2);
+GLAPI GLint GLAPIENTRY glRenderMode (GLenum mode);
+GLAPI void GLAPIENTRY glRotated (GLdouble angle, GLdouble x, GLdouble y, GLdouble z);
+GLAPI void GLAPIENTRY glRotatef (GLfloat angle, GLfloat x, GLfloat y, GLfloat z);
+GLAPI void GLAPIENTRY glScaled (GLdouble x, GLdouble y, GLdouble z);
+GLAPI void GLAPIENTRY glScalef (GLfloat x, GLfloat y, GLfloat z);
+GLAPI void GLAPIENTRY glScissor (GLint x, GLint y, GLsizei width, GLsizei height);
+GLAPI void GLAPIENTRY glSelectBuffer (GLsizei size, GLuint *buffer);
+GLAPI void GLAPIENTRY glShadeModel (GLenum mode);
+GLAPI void GLAPIENTRY glStencilFunc (GLenum func, GLint ref, GLuint mask);
+GLAPI void GLAPIENTRY glStencilMask (GLuint mask);
+GLAPI void GLAPIENTRY glStencilOp (GLenum fail, GLenum zfail, GLenum zpass);
+GLAPI void GLAPIENTRY glTexCoord1d (GLdouble s);
+GLAPI void GLAPIENTRY glTexCoord1dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glTexCoord1f (GLfloat s);
+GLAPI void GLAPIENTRY glTexCoord1fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glTexCoord1i (GLint s);
+GLAPI void GLAPIENTRY glTexCoord1iv (const GLint *v);
+GLAPI void GLAPIENTRY glTexCoord1s (GLshort s);
+GLAPI void GLAPIENTRY glTexCoord1sv (const GLshort *v);
+GLAPI void GLAPIENTRY glTexCoord2d (GLdouble s, GLdouble t);
+GLAPI void GLAPIENTRY glTexCoord2dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glTexCoord2f (GLfloat s, GLfloat t);
+GLAPI void GLAPIENTRY glTexCoord2fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glTexCoord2i (GLint s, GLint t);
+GLAPI void GLAPIENTRY glTexCoord2iv (const GLint *v);
+GLAPI void GLAPIENTRY glTexCoord2s (GLshort s, GLshort t);
+GLAPI void GLAPIENTRY glTexCoord2sv (const GLshort *v);
+GLAPI void GLAPIENTRY glTexCoord3d (GLdouble s, GLdouble t, GLdouble r);
+GLAPI void GLAPIENTRY glTexCoord3dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glTexCoord3f (GLfloat s, GLfloat t, GLfloat r);
+GLAPI void GLAPIENTRY glTexCoord3fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glTexCoord3i (GLint s, GLint t, GLint r);
+GLAPI void GLAPIENTRY glTexCoord3iv (const GLint *v);
+GLAPI void GLAPIENTRY glTexCoord3s (GLshort s, GLshort t, GLshort r);
+GLAPI void GLAPIENTRY glTexCoord3sv (const GLshort *v);
+GLAPI void GLAPIENTRY glTexCoord4d (GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+GLAPI void GLAPIENTRY glTexCoord4dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glTexCoord4f (GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+GLAPI void GLAPIENTRY glTexCoord4fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glTexCoord4i (GLint s, GLint t, GLint r, GLint q);
+GLAPI void GLAPIENTRY glTexCoord4iv (const GLint *v);
+GLAPI void GLAPIENTRY glTexCoord4s (GLshort s, GLshort t, GLshort r, GLshort q);
+GLAPI void GLAPIENTRY glTexCoord4sv (const GLshort *v);
+GLAPI void GLAPIENTRY glTexCoordPointer (GLint size, GLenum type, GLsizei stride, const void *pointer);
+GLAPI void GLAPIENTRY glTexEnvf (GLenum target, GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glTexEnvfv (GLenum target, GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glTexEnvi (GLenum target, GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glTexEnviv (GLenum target, GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glTexGend (GLenum coord, GLenum pname, GLdouble param);
+GLAPI void GLAPIENTRY glTexGendv (GLenum coord, GLenum pname, const GLdouble *params);
+GLAPI void GLAPIENTRY glTexGenf (GLenum coord, GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glTexGenfv (GLenum coord, GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glTexGeni (GLenum coord, GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glTexGeniv (GLenum coord, GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glTexImage1D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels);
+GLAPI void GLAPIENTRY glTexImage2D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels);
+GLAPI void GLAPIENTRY glTexParameterf (GLenum target, GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glTexParameterfv (GLenum target, GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glTexParameteri (GLenum target, GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glTexParameteriv (GLenum target, GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glTexSubImage1D (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels);
+GLAPI void GLAPIENTRY glTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels);
+GLAPI void GLAPIENTRY glTranslated (GLdouble x, GLdouble y, GLdouble z);
+GLAPI void GLAPIENTRY glTranslatef (GLfloat x, GLfloat y, GLfloat z);
+GLAPI void GLAPIENTRY glVertex2d (GLdouble x, GLdouble y);
+GLAPI void GLAPIENTRY glVertex2dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glVertex2f (GLfloat x, GLfloat y);
+GLAPI void GLAPIENTRY glVertex2fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glVertex2i (GLint x, GLint y);
+GLAPI void GLAPIENTRY glVertex2iv (const GLint *v);
+GLAPI void GLAPIENTRY glVertex2s (GLshort x, GLshort y);
+GLAPI void GLAPIENTRY glVertex2sv (const GLshort *v);
+GLAPI void GLAPIENTRY glVertex3d (GLdouble x, GLdouble y, GLdouble z);
+GLAPI void GLAPIENTRY glVertex3dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glVertex3f (GLfloat x, GLfloat y, GLfloat z);
+GLAPI void GLAPIENTRY glVertex3fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glVertex3i (GLint x, GLint y, GLint z);
+GLAPI void GLAPIENTRY glVertex3iv (const GLint *v);
+GLAPI void GLAPIENTRY glVertex3s (GLshort x, GLshort y, GLshort z);
+GLAPI void GLAPIENTRY glVertex3sv (const GLshort *v);
+GLAPI void GLAPIENTRY glVertex4d (GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+GLAPI void GLAPIENTRY glVertex4dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glVertex4f (GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+GLAPI void GLAPIENTRY glVertex4fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glVertex4i (GLint x, GLint y, GLint z, GLint w);
+GLAPI void GLAPIENTRY glVertex4iv (const GLint *v);
+GLAPI void GLAPIENTRY glVertex4s (GLshort x, GLshort y, GLshort z, GLshort w);
+GLAPI void GLAPIENTRY glVertex4sv (const GLshort *v);
+GLAPI void GLAPIENTRY glVertexPointer (GLint size, GLenum type, GLsizei stride, const void *pointer);
+GLAPI void GLAPIENTRY glViewport (GLint x, GLint y, GLsizei width, GLsizei height);
+#endif /* GL_VERSION_1_1 */
+/* ---------------------------------- GLU ---------------------------------- */
+#ifndef GLEW_NO_GLU
+# ifdef __APPLE__
+# include <Availability.h>
+# define GLEW_NO_GLU
+# endif
+# endif
+#ifndef GLEW_NO_GLU
+/* this is where we can safely include GLU */
+# if defined(__APPLE__) && defined(__MACH__)
+# include <OpenGL/glu.h>
+# else
+# include <GL/glu.h>
+# endif
+/* ----------------------------- GL_VERSION_1_2 ---------------------------- */
+#ifndef GL_VERSION_1_2
+#define GL_VERSION_1_2 1
+#define GL_UNSIGNED_BYTE_3_3_2 0x8032
+#define GL_UNSIGNED_SHORT_4_4_4_4 0x8033
+#define GL_UNSIGNED_SHORT_5_5_5_1 0x8034
+#define GL_UNSIGNED_INT_8_8_8_8 0x8035
+#define GL_UNSIGNED_INT_10_10_10_2 0x8036
+#define GL_RESCALE_NORMAL 0x803A
+#define GL_TEXTURE_BINDING_3D 0x806A
+#define GL_PACK_SKIP_IMAGES 0x806B
+#define GL_PACK_IMAGE_HEIGHT 0x806C
+#define GL_TEXTURE_3D 0x806F
+#define GL_PROXY_TEXTURE_3D 0x8070
+#define GL_TEXTURE_DEPTH 0x8071
+#define GL_TEXTURE_WRAP_R 0x8072
+#define GL_MAX_3D_TEXTURE_SIZE 0x8073
+#define GL_BGR 0x80E0
+#define GL_BGRA 0x80E1
+#define GL_CLAMP_TO_EDGE 0x812F
+#define GL_TEXTURE_MIN_LOD 0x813A
+#define GL_TEXTURE_MAX_LOD 0x813B
+#define GL_TEXTURE_MAX_LEVEL 0x813D
+#define GL_SINGLE_COLOR 0x81F9
+#define GL_UNSIGNED_BYTE_2_3_3_REV 0x8362
+#define GL_UNSIGNED_SHORT_5_6_5 0x8363
+#define GL_UNSIGNED_SHORT_5_6_5_REV 0x8364
+#define GL_UNSIGNED_SHORT_4_4_4_4_REV 0x8365
+#define GL_UNSIGNED_SHORT_1_5_5_5_REV 0x8366
+#define GL_UNSIGNED_INT_8_8_8_8_REV 0x8367
+typedef void (GLAPIENTRY * PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices);
+typedef void (GLAPIENTRY * PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels);
+#define glCopyTexSubImage3D GLEW_GET_FUN(__glewCopyTexSubImage3D)
+#define glDrawRangeElements GLEW_GET_FUN(__glewDrawRangeElements)
+#define glTexImage3D GLEW_GET_FUN(__glewTexImage3D)
+#define glTexSubImage3D GLEW_GET_FUN(__glewTexSubImage3D)
+#endif /* GL_VERSION_1_2 */
+/* ---------------------------- GL_VERSION_1_2_1 --------------------------- */
+#ifndef GL_VERSION_1_2_1
+#define GL_VERSION_1_2_1 1
+#endif /* GL_VERSION_1_2_1 */
+/* ----------------------------- GL_VERSION_1_3 ---------------------------- */
+#ifndef GL_VERSION_1_3
+#define GL_VERSION_1_3 1
+#define GL_MULTISAMPLE 0x809D
+#define GL_SAMPLE_ALPHA_TO_ONE 0x809F
+#define GL_SAMPLE_COVERAGE 0x80A0
+#define GL_SAMPLE_BUFFERS 0x80A8
+#define GL_SAMPLES 0x80A9
+#define GL_CLAMP_TO_BORDER 0x812D
+#define GL_TEXTURE0 0x84C0
+#define GL_TEXTURE1 0x84C1
+#define GL_TEXTURE2 0x84C2
+#define GL_TEXTURE3 0x84C3
+#define GL_TEXTURE4 0x84C4
+#define GL_TEXTURE5 0x84C5
+#define GL_TEXTURE6 0x84C6
+#define GL_TEXTURE7 0x84C7
+#define GL_TEXTURE8 0x84C8
+#define GL_TEXTURE9 0x84C9
+#define GL_TEXTURE10 0x84CA
+#define GL_TEXTURE11 0x84CB
+#define GL_TEXTURE12 0x84CC
+#define GL_TEXTURE13 0x84CD
+#define GL_TEXTURE14 0x84CE
+#define GL_TEXTURE15 0x84CF
+#define GL_TEXTURE16 0x84D0
+#define GL_TEXTURE17 0x84D1
+#define GL_TEXTURE18 0x84D2
+#define GL_TEXTURE19 0x84D3
+#define GL_TEXTURE20 0x84D4
+#define GL_TEXTURE21 0x84D5
+#define GL_TEXTURE22 0x84D6
+#define GL_TEXTURE23 0x84D7
+#define GL_TEXTURE24 0x84D8
+#define GL_TEXTURE25 0x84D9
+#define GL_TEXTURE26 0x84DA
+#define GL_TEXTURE27 0x84DB
+#define GL_TEXTURE28 0x84DC
+#define GL_TEXTURE29 0x84DD
+#define GL_TEXTURE30 0x84DE
+#define GL_TEXTURE31 0x84DF
+#define GL_ACTIVE_TEXTURE 0x84E0
+#define GL_MAX_TEXTURE_UNITS 0x84E2
+#define GL_SUBTRACT 0x84E7
+#define GL_NORMAL_MAP 0x8511
+#define GL_REFLECTION_MAP 0x8512
+#define GL_TEXTURE_CUBE_MAP 0x8513
+#define GL_COMBINE 0x8570
+#define GL_COMBINE_RGB 0x8571
+#define GL_COMBINE_ALPHA 0x8572
+#define GL_RGB_SCALE 0x8573
+#define GL_ADD_SIGNED 0x8574
+#define GL_INTERPOLATE 0x8575
+#define GL_CONSTANT 0x8576
+#define GL_PRIMARY_COLOR 0x8577
+#define GL_PREVIOUS 0x8578
+#define GL_SOURCE0_RGB 0x8580
+#define GL_SOURCE1_RGB 0x8581
+#define GL_SOURCE2_RGB 0x8582
+#define GL_SOURCE0_ALPHA 0x8588
+#define GL_SOURCE1_ALPHA 0x8589
+#define GL_SOURCE2_ALPHA 0x858A
+#define GL_OPERAND0_RGB 0x8590
+#define GL_OPERAND1_RGB 0x8591
+#define GL_OPERAND2_RGB 0x8592
+#define GL_OPERAND0_ALPHA 0x8598
+#define GL_OPERAND1_ALPHA 0x8599
+#define GL_OPERAND2_ALPHA 0x859A
+#define GL_DOT3_RGB 0x86AE
+#define GL_DOT3_RGBA 0x86AF
+#define GL_MULTISAMPLE_BIT 0x20000000
+typedef void (GLAPIENTRY * PFNGLACTIVETEXTUREPROC) (GLenum texture);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint lod, void *img);
+typedef void (GLAPIENTRY * PFNGLLOADTRANSPOSEMATRIXDPROC) (const GLdouble m[16]);
+typedef void (GLAPIENTRY * PFNGLMULTTRANSPOSEMATRIXDPROC) (const GLdouble m[16]);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1FPROC) (GLenum target, GLfloat s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1FVPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1IPROC) (GLenum target, GLint s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1IVPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1SPROC) (GLenum target, GLshort s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1SVPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2DPROC) (GLenum target, GLdouble s, GLdouble t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2DVPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2FPROC) (GLenum target, GLfloat s, GLfloat t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2FVPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2IPROC) (GLenum target, GLint s, GLint t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2IVPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2SPROC) (GLenum target, GLshort s, GLshort t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2SVPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3DVPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3FVPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3IPROC) (GLenum target, GLint s, GLint t, GLint r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3IVPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3SPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3SVPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4DVPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4FVPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4IPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4IVPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4SPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4SVPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLSAMPLECOVERAGEPROC) (GLclampf value, GLboolean invert);
+#define glActiveTexture GLEW_GET_FUN(__glewActiveTexture)
+#define glClientActiveTexture GLEW_GET_FUN(__glewClientActiveTexture)
+#define glCompressedTexImage1D GLEW_GET_FUN(__glewCompressedTexImage1D)
+#define glCompressedTexImage2D GLEW_GET_FUN(__glewCompressedTexImage2D)
+#define glCompressedTexImage3D GLEW_GET_FUN(__glewCompressedTexImage3D)
+#define glCompressedTexSubImage1D GLEW_GET_FUN(__glewCompressedTexSubImage1D)
+#define glCompressedTexSubImage2D GLEW_GET_FUN(__glewCompressedTexSubImage2D)
+#define glCompressedTexSubImage3D GLEW_GET_FUN(__glewCompressedTexSubImage3D)
+#define glGetCompressedTexImage GLEW_GET_FUN(__glewGetCompressedTexImage)
+#define glLoadTransposeMatrixd GLEW_GET_FUN(__glewLoadTransposeMatrixd)
+#define glLoadTransposeMatrixf GLEW_GET_FUN(__glewLoadTransposeMatrixf)
+#define glMultTransposeMatrixd GLEW_GET_FUN(__glewMultTransposeMatrixd)
+#define glMultTransposeMatrixf GLEW_GET_FUN(__glewMultTransposeMatrixf)
+#define glMultiTexCoord1d GLEW_GET_FUN(__glewMultiTexCoord1d)
+#define glMultiTexCoord1dv GLEW_GET_FUN(__glewMultiTexCoord1dv)
+#define glMultiTexCoord1f GLEW_GET_FUN(__glewMultiTexCoord1f)
+#define glMultiTexCoord1fv GLEW_GET_FUN(__glewMultiTexCoord1fv)
+#define glMultiTexCoord1i GLEW_GET_FUN(__glewMultiTexCoord1i)
+#define glMultiTexCoord1iv GLEW_GET_FUN(__glewMultiTexCoord1iv)
+#define glMultiTexCoord1s GLEW_GET_FUN(__glewMultiTexCoord1s)
+#define glMultiTexCoord1sv GLEW_GET_FUN(__glewMultiTexCoord1sv)
+#define glMultiTexCoord2d GLEW_GET_FUN(__glewMultiTexCoord2d)
+#define glMultiTexCoord2dv GLEW_GET_FUN(__glewMultiTexCoord2dv)
+#define glMultiTexCoord2f GLEW_GET_FUN(__glewMultiTexCoord2f)
+#define glMultiTexCoord2fv GLEW_GET_FUN(__glewMultiTexCoord2fv)
+#define glMultiTexCoord2i GLEW_GET_FUN(__glewMultiTexCoord2i)
+#define glMultiTexCoord2iv GLEW_GET_FUN(__glewMultiTexCoord2iv)
+#define glMultiTexCoord2s GLEW_GET_FUN(__glewMultiTexCoord2s)
+#define glMultiTexCoord2sv GLEW_GET_FUN(__glewMultiTexCoord2sv)
+#define glMultiTexCoord3d GLEW_GET_FUN(__glewMultiTexCoord3d)
+#define glMultiTexCoord3dv GLEW_GET_FUN(__glewMultiTexCoord3dv)
+#define glMultiTexCoord3f GLEW_GET_FUN(__glewMultiTexCoord3f)
+#define glMultiTexCoord3fv GLEW_GET_FUN(__glewMultiTexCoord3fv)
+#define glMultiTexCoord3i GLEW_GET_FUN(__glewMultiTexCoord3i)
+#define glMultiTexCoord3iv GLEW_GET_FUN(__glewMultiTexCoord3iv)
+#define glMultiTexCoord3s GLEW_GET_FUN(__glewMultiTexCoord3s)
+#define glMultiTexCoord3sv GLEW_GET_FUN(__glewMultiTexCoord3sv)
+#define glMultiTexCoord4d GLEW_GET_FUN(__glewMultiTexCoord4d)
+#define glMultiTexCoord4dv GLEW_GET_FUN(__glewMultiTexCoord4dv)
+#define glMultiTexCoord4f GLEW_GET_FUN(__glewMultiTexCoord4f)
+#define glMultiTexCoord4fv GLEW_GET_FUN(__glewMultiTexCoord4fv)
+#define glMultiTexCoord4i GLEW_GET_FUN(__glewMultiTexCoord4i)
+#define glMultiTexCoord4iv GLEW_GET_FUN(__glewMultiTexCoord4iv)
+#define glMultiTexCoord4s GLEW_GET_FUN(__glewMultiTexCoord4s)
+#define glMultiTexCoord4sv GLEW_GET_FUN(__glewMultiTexCoord4sv)
+#define glSampleCoverage GLEW_GET_FUN(__glewSampleCoverage)
+#endif /* GL_VERSION_1_3 */
+/* ----------------------------- GL_VERSION_1_4 ---------------------------- */
+#ifndef GL_VERSION_1_4
+#define GL_VERSION_1_4 1
+#define GL_BLEND_DST_RGB 0x80C8
+#define GL_BLEND_SRC_RGB 0x80C9
+#define GL_BLEND_DST_ALPHA 0x80CA
+#define GL_BLEND_SRC_ALPHA 0x80CB
+#define GL_POINT_SIZE_MIN 0x8126
+#define GL_POINT_SIZE_MAX 0x8127
+#define GL_GENERATE_MIPMAP 0x8191
+#define GL_DEPTH_COMPONENT16 0x81A5
+#define GL_DEPTH_COMPONENT24 0x81A6
+#define GL_DEPTH_COMPONENT32 0x81A7
+#define GL_MIRRORED_REPEAT 0x8370
+#define GL_FOG_COORDINATE 0x8451
+#define GL_FRAGMENT_DEPTH 0x8452
+#define GL_COLOR_SUM 0x8458
+#define GL_TEXTURE_LOD_BIAS 0x8501
+#define GL_INCR_WRAP 0x8507
+#define GL_DECR_WRAP 0x8508
+typedef void (GLAPIENTRY * PFNGLBLENDCOLORPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const void *pointer);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDDPROC) (GLdouble coord);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDDVPROC) (const GLdouble *coord);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDFPROC) (GLfloat coord);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDFVPROC) (const GLfloat *coord);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei drawcount);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const* indices, GLsizei drawcount);
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERFVPROC) (GLenum pname, const GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERIPROC) (GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERIVPROC) (GLenum pname, const GLint *params);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3BPROC) (GLbyte red, GLbyte green, GLbyte blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3BVPROC) (const GLbyte *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3DPROC) (GLdouble red, GLdouble green, GLdouble blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3DVPROC) (const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3FPROC) (GLfloat red, GLfloat green, GLfloat blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3FVPROC) (const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3IPROC) (GLint red, GLint green, GLint blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3SPROC) (GLshort red, GLshort green, GLshort blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3SVPROC) (const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3UBPROC) (GLubyte red, GLubyte green, GLubyte blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3UBVPROC) (const GLubyte *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3UIPROC) (GLuint red, GLuint green, GLuint blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3USPROC) (GLushort red, GLushort green, GLushort blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3USVPROC) (const GLushort *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2DPROC) (GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2DVPROC) (const GLdouble *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2FPROC) (GLfloat x, GLfloat y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2FVPROC) (const GLfloat *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2IPROC) (GLint x, GLint y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2IVPROC) (const GLint *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2SPROC) (GLshort x, GLshort y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2SVPROC) (const GLshort *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3DPROC) (GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3DVPROC) (const GLdouble *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3FPROC) (GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3FVPROC) (const GLfloat *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3IPROC) (GLint x, GLint y, GLint z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3IVPROC) (const GLint *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3SPROC) (GLshort x, GLshort y, GLshort z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3SVPROC) (const GLshort *p);
+#define glBlendColor GLEW_GET_FUN(__glewBlendColor)
+#define glBlendEquation GLEW_GET_FUN(__glewBlendEquation)
+#define glBlendFuncSeparate GLEW_GET_FUN(__glewBlendFuncSeparate)
+#define glFogCoordPointer GLEW_GET_FUN(__glewFogCoordPointer)
+#define glFogCoordd GLEW_GET_FUN(__glewFogCoordd)
+#define glFogCoorddv GLEW_GET_FUN(__glewFogCoorddv)
+#define glFogCoordf GLEW_GET_FUN(__glewFogCoordf)
+#define glFogCoordfv GLEW_GET_FUN(__glewFogCoordfv)
+#define glMultiDrawArrays GLEW_GET_FUN(__glewMultiDrawArrays)
+#define glMultiDrawElements GLEW_GET_FUN(__glewMultiDrawElements)
+#define glPointParameterf GLEW_GET_FUN(__glewPointParameterf)
+#define glPointParameterfv GLEW_GET_FUN(__glewPointParameterfv)
+#define glPointParameteri GLEW_GET_FUN(__glewPointParameteri)
+#define glPointParameteriv GLEW_GET_FUN(__glewPointParameteriv)
+#define glSecondaryColor3b GLEW_GET_FUN(__glewSecondaryColor3b)
+#define glSecondaryColor3bv GLEW_GET_FUN(__glewSecondaryColor3bv)
+#define glSecondaryColor3d GLEW_GET_FUN(__glewSecondaryColor3d)
+#define glSecondaryColor3dv GLEW_GET_FUN(__glewSecondaryColor3dv)
+#define glSecondaryColor3f GLEW_GET_FUN(__glewSecondaryColor3f)
+#define glSecondaryColor3fv GLEW_GET_FUN(__glewSecondaryColor3fv)
+#define glSecondaryColor3i GLEW_GET_FUN(__glewSecondaryColor3i)
+#define glSecondaryColor3iv GLEW_GET_FUN(__glewSecondaryColor3iv)
+#define glSecondaryColor3s GLEW_GET_FUN(__glewSecondaryColor3s)
+#define glSecondaryColor3sv GLEW_GET_FUN(__glewSecondaryColor3sv)
+#define glSecondaryColor3ub GLEW_GET_FUN(__glewSecondaryColor3ub)
+#define glSecondaryColor3ubv GLEW_GET_FUN(__glewSecondaryColor3ubv)
+#define glSecondaryColor3ui GLEW_GET_FUN(__glewSecondaryColor3ui)
+#define glSecondaryColor3uiv GLEW_GET_FUN(__glewSecondaryColor3uiv)
+#define glSecondaryColor3us GLEW_GET_FUN(__glewSecondaryColor3us)
+#define glSecondaryColor3usv GLEW_GET_FUN(__glewSecondaryColor3usv)
+#define glSecondaryColorPointer GLEW_GET_FUN(__glewSecondaryColorPointer)
+#define glWindowPos2d GLEW_GET_FUN(__glewWindowPos2d)
+#define glWindowPos2dv GLEW_GET_FUN(__glewWindowPos2dv)
+#define glWindowPos2f GLEW_GET_FUN(__glewWindowPos2f)
+#define glWindowPos2fv GLEW_GET_FUN(__glewWindowPos2fv)
+#define glWindowPos2i GLEW_GET_FUN(__glewWindowPos2i)
+#define glWindowPos2iv GLEW_GET_FUN(__glewWindowPos2iv)
+#define glWindowPos2s GLEW_GET_FUN(__glewWindowPos2s)
+#define glWindowPos2sv GLEW_GET_FUN(__glewWindowPos2sv)
+#define glWindowPos3d GLEW_GET_FUN(__glewWindowPos3d)
+#define glWindowPos3dv GLEW_GET_FUN(__glewWindowPos3dv)
+#define glWindowPos3f GLEW_GET_FUN(__glewWindowPos3f)
+#define glWindowPos3fv GLEW_GET_FUN(__glewWindowPos3fv)
+#define glWindowPos3i GLEW_GET_FUN(__glewWindowPos3i)
+#define glWindowPos3iv GLEW_GET_FUN(__glewWindowPos3iv)
+#define glWindowPos3s GLEW_GET_FUN(__glewWindowPos3s)
+#define glWindowPos3sv GLEW_GET_FUN(__glewWindowPos3sv)
+#endif /* GL_VERSION_1_4 */
+/* ----------------------------- GL_VERSION_1_5 ---------------------------- */
+#ifndef GL_VERSION_1_5
+#define GL_VERSION_1_5 1
+#define GL_BUFFER_SIZE 0x8764
+#define GL_BUFFER_USAGE 0x8765
+#define GL_QUERY_COUNTER_BITS 0x8864
+#define GL_CURRENT_QUERY 0x8865
+#define GL_QUERY_RESULT 0x8866
+#define GL_ARRAY_BUFFER 0x8892
+#define GL_READ_ONLY 0x88B8
+#define GL_WRITE_ONLY 0x88B9
+#define GL_READ_WRITE 0x88BA
+#define GL_BUFFER_ACCESS 0x88BB
+#define GL_BUFFER_MAPPED 0x88BC
+#define GL_STREAM_DRAW 0x88E0
+#define GL_STREAM_READ 0x88E1
+#define GL_STREAM_COPY 0x88E2
+#define GL_STATIC_DRAW 0x88E4
+#define GL_STATIC_READ 0x88E5
+#define GL_STATIC_COPY 0x88E6
+#define GL_DYNAMIC_DRAW 0x88E8
+#define GL_DYNAMIC_READ 0x88E9
+#define GL_DYNAMIC_COPY 0x88EA
+#define GL_SAMPLES_PASSED 0x8914
+typedef ptrdiff_t GLintptr;
+typedef ptrdiff_t GLsizeiptr;
+typedef void (GLAPIENTRY * PFNGLBEGINQUERYPROC) (GLenum target, GLuint id);
+typedef void (GLAPIENTRY * PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer);
+typedef void (GLAPIENTRY * PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const void* data, GLenum usage);
+typedef void (GLAPIENTRY * PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const void* data);
+typedef void (GLAPIENTRY * PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint* buffers);
+typedef void (GLAPIENTRY * PFNGLDELETEQUERIESPROC) (GLsizei n, const GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLENDQUERYPROC) (GLenum target);
+typedef void (GLAPIENTRY * PFNGLGENBUFFERSPROC) (GLsizei n, GLuint* buffers);
+typedef void (GLAPIENTRY * PFNGLGENQUERIESPROC) (GLsizei n, GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, void** params);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, void* data);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTIVPROC) (GLuint id, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTUIVPROC) (GLuint id, GLenum pname, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYIVPROC) (GLenum target, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISBUFFERPROC) (GLuint buffer);
+typedef GLboolean (GLAPIENTRY * PFNGLISQUERYPROC) (GLuint id);
+typedef void* (GLAPIENTRY * PFNGLMAPBUFFERPROC) (GLenum target, GLenum access);
+typedef GLboolean (GLAPIENTRY * PFNGLUNMAPBUFFERPROC) (GLenum target);
+#define glBeginQuery GLEW_GET_FUN(__glewBeginQuery)
+#define glBindBuffer GLEW_GET_FUN(__glewBindBuffer)
+#define glBufferData GLEW_GET_FUN(__glewBufferData)
+#define glBufferSubData GLEW_GET_FUN(__glewBufferSubData)
+#define glDeleteBuffers GLEW_GET_FUN(__glewDeleteBuffers)
+#define glDeleteQueries GLEW_GET_FUN(__glewDeleteQueries)
+#define glEndQuery GLEW_GET_FUN(__glewEndQuery)
+#define glGenBuffers GLEW_GET_FUN(__glewGenBuffers)
+#define glGenQueries GLEW_GET_FUN(__glewGenQueries)
+#define glGetBufferParameteriv GLEW_GET_FUN(__glewGetBufferParameteriv)
+#define glGetBufferPointerv GLEW_GET_FUN(__glewGetBufferPointerv)
+#define glGetBufferSubData GLEW_GET_FUN(__glewGetBufferSubData)
+#define glGetQueryObjectiv GLEW_GET_FUN(__glewGetQueryObjectiv)
+#define glGetQueryObjectuiv GLEW_GET_FUN(__glewGetQueryObjectuiv)
+#define glGetQueryiv GLEW_GET_FUN(__glewGetQueryiv)
+#define glIsBuffer GLEW_GET_FUN(__glewIsBuffer)
+#define glIsQuery GLEW_GET_FUN(__glewIsQuery)
+#define glMapBuffer GLEW_GET_FUN(__glewMapBuffer)
+#define glUnmapBuffer GLEW_GET_FUN(__glewUnmapBuffer)
+#endif /* GL_VERSION_1_5 */
+/* ----------------------------- GL_VERSION_2_0 ---------------------------- */
+#ifndef GL_VERSION_2_0
+#define GL_VERSION_2_0 1
+#define GL_STENCIL_BACK_FUNC 0x8800
+#define GL_STENCIL_BACK_FAIL 0x8801
+#define GL_MAX_DRAW_BUFFERS 0x8824
+#define GL_DRAW_BUFFER0 0x8825
+#define GL_DRAW_BUFFER1 0x8826
+#define GL_DRAW_BUFFER2 0x8827
+#define GL_DRAW_BUFFER3 0x8828
+#define GL_DRAW_BUFFER4 0x8829
+#define GL_DRAW_BUFFER5 0x882A
+#define GL_DRAW_BUFFER6 0x882B
+#define GL_DRAW_BUFFER7 0x882C
+#define GL_DRAW_BUFFER8 0x882D
+#define GL_DRAW_BUFFER9 0x882E
+#define GL_DRAW_BUFFER10 0x882F
+#define GL_DRAW_BUFFER11 0x8830
+#define GL_DRAW_BUFFER12 0x8831
+#define GL_DRAW_BUFFER13 0x8832
+#define GL_DRAW_BUFFER14 0x8833
+#define GL_DRAW_BUFFER15 0x8834
+#define GL_POINT_SPRITE 0x8861
+#define GL_COORD_REPLACE 0x8862
+#define GL_MAX_VERTEX_ATTRIBS 0x8869
+#define GL_MAX_TEXTURE_COORDS 0x8871
+#define GL_FRAGMENT_SHADER 0x8B30
+#define GL_VERTEX_SHADER 0x8B31
+#define GL_SHADER_TYPE 0x8B4F
+#define GL_FLOAT_VEC2 0x8B50
+#define GL_FLOAT_VEC3 0x8B51
+#define GL_FLOAT_VEC4 0x8B52
+#define GL_INT_VEC2 0x8B53
+#define GL_INT_VEC3 0x8B54
+#define GL_INT_VEC4 0x8B55
+#define GL_BOOL 0x8B56
+#define GL_BOOL_VEC2 0x8B57
+#define GL_BOOL_VEC3 0x8B58
+#define GL_BOOL_VEC4 0x8B59
+#define GL_FLOAT_MAT2 0x8B5A
+#define GL_FLOAT_MAT3 0x8B5B
+#define GL_FLOAT_MAT4 0x8B5C
+#define GL_SAMPLER_1D 0x8B5D
+#define GL_SAMPLER_2D 0x8B5E
+#define GL_SAMPLER_3D 0x8B5F
+#define GL_SAMPLER_CUBE 0x8B60
+#define GL_SAMPLER_1D_SHADOW 0x8B61
+#define GL_SAMPLER_2D_SHADOW 0x8B62
+#define GL_DELETE_STATUS 0x8B80
+#define GL_COMPILE_STATUS 0x8B81
+#define GL_LINK_STATUS 0x8B82
+#define GL_VALIDATE_STATUS 0x8B83
+#define GL_INFO_LOG_LENGTH 0x8B84
+#define GL_ACTIVE_UNIFORMS 0x8B86
+#define GL_LOWER_LEFT 0x8CA1
+#define GL_UPPER_LEFT 0x8CA2
+typedef void (GLAPIENTRY * PFNGLATTACHSHADERPROC) (GLuint program, GLuint shader);
+typedef void (GLAPIENTRY * PFNGLBINDATTRIBLOCATIONPROC) (GLuint program, GLuint index, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLCOMPILESHADERPROC) (GLuint shader);
+typedef void (GLAPIENTRY * PFNGLDELETEPROGRAMPROC) (GLuint program);
+typedef void (GLAPIENTRY * PFNGLDELETESHADERPROC) (GLuint shader);
+typedef void (GLAPIENTRY * PFNGLDETACHSHADERPROC) (GLuint program, GLuint shader);
+typedef void (GLAPIENTRY * PFNGLDRAWBUFFERSPROC) (GLsizei n, const GLenum* bufs);
+typedef void (GLAPIENTRY * PFNGLGETACTIVEATTRIBPROC) (GLuint program, GLuint index, GLsizei maxLength, GLsizei* length, GLint* size, GLenum* type, GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETACTIVEUNIFORMPROC) (GLuint program, GLuint index, GLsizei maxLength, GLsizei* length, GLint* size, GLenum* type, GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETATTACHEDSHADERSPROC) (GLuint program, GLsizei maxCount, GLsizei* count, GLuint* shaders);
+typedef GLint (GLAPIENTRY * PFNGLGETATTRIBLOCATIONPROC) (GLuint program, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMINFOLOGPROC) (GLuint program, GLsizei bufSize, GLsizei* length, GLchar* infoLog);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMIVPROC) (GLuint program, GLenum pname, GLint* param);
+typedef void (GLAPIENTRY * PFNGLGETSHADERINFOLOGPROC) (GLuint shader, GLsizei bufSize, GLsizei* length, GLchar* infoLog);
+typedef void (GLAPIENTRY * PFNGLGETSHADERSOURCEPROC) (GLuint obj, GLsizei maxLength, GLsizei* length, GLchar* source);
+typedef void (GLAPIENTRY * PFNGLGETSHADERIVPROC) (GLuint shader, GLenum pname, GLint* param);
+typedef GLint (GLAPIENTRY * PFNGLGETUNIFORMLOCATIONPROC) (GLuint program, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMFVPROC) (GLuint program, GLint location, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, void** pointer);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBDVPROC) (GLuint index, GLenum pname, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBFVPROC) (GLuint index, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBIVPROC) (GLuint index, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISPROGRAMPROC) (GLuint program);
+typedef GLboolean (GLAPIENTRY * PFNGLISSHADERPROC) (GLuint shader);
+typedef void (GLAPIENTRY * PFNGLLINKPROGRAMPROC) (GLuint program);
+typedef void (GLAPIENTRY * PFNGLSHADERSOURCEPROC) (GLuint shader, GLsizei count, const GLchar *const* string, const GLint* length);
+typedef void (GLAPIENTRY * PFNGLSTENCILFUNCSEPARATEPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask);
+typedef void (GLAPIENTRY * PFNGLSTENCILMASKSEPARATEPROC) (GLenum face, GLuint mask);
+typedef void (GLAPIENTRY * PFNGLSTENCILOPSEPARATEPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1FPROC) (GLint location, GLfloat v0);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1FVPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1IPROC) (GLint location, GLint v0);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1IVPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2FPROC) (GLint location, GLfloat v0, GLfloat v1);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2FVPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2IPROC) (GLint location, GLint v0, GLint v1);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2IVPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3FVPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3IPROC) (GLint location, GLint v0, GLint v1, GLint v2);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3IVPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4FVPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4IPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4IVPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUSEPROGRAMPROC) (GLuint program);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1DPROC) (GLuint index, GLdouble x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1DVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1FPROC) (GLuint index, GLfloat x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1FVPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1SPROC) (GLuint index, GLshort x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1SVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2DPROC) (GLuint index, GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2DVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2FPROC) (GLuint index, GLfloat x, GLfloat y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2FVPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2SPROC) (GLuint index, GLshort x, GLshort y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2SVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3DVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3FVPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3SPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3SVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NBVPROC) (GLuint index, const GLbyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NIVPROC) (GLuint index, const GLint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NSVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUBVPROC) (GLuint index, const GLubyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUIVPROC) (GLuint index, const GLuint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUSVPROC) (GLuint index, const GLushort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4BVPROC) (GLuint index, const GLbyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4DVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4FVPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4IVPROC) (GLuint index, const GLint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4SPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4SVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4UBVPROC) (GLuint index, const GLubyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4UIVPROC) (GLuint index, const GLuint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4USVPROC) (GLuint index, const GLushort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void* pointer);
+#define glAttachShader GLEW_GET_FUN(__glewAttachShader)
+#define glBindAttribLocation GLEW_GET_FUN(__glewBindAttribLocation)
+#define glBlendEquationSeparate GLEW_GET_FUN(__glewBlendEquationSeparate)
+#define glCompileShader GLEW_GET_FUN(__glewCompileShader)
+#define glCreateProgram GLEW_GET_FUN(__glewCreateProgram)
+#define glCreateShader GLEW_GET_FUN(__glewCreateShader)
+#define glDeleteProgram GLEW_GET_FUN(__glewDeleteProgram)
+#define glDeleteShader GLEW_GET_FUN(__glewDeleteShader)
+#define glDetachShader GLEW_GET_FUN(__glewDetachShader)
+#define glDisableVertexAttribArray GLEW_GET_FUN(__glewDisableVertexAttribArray)
+#define glDrawBuffers GLEW_GET_FUN(__glewDrawBuffers)
+#define glEnableVertexAttribArray GLEW_GET_FUN(__glewEnableVertexAttribArray)
+#define glGetActiveAttrib GLEW_GET_FUN(__glewGetActiveAttrib)
+#define glGetActiveUniform GLEW_GET_FUN(__glewGetActiveUniform)
+#define glGetAttachedShaders GLEW_GET_FUN(__glewGetAttachedShaders)
+#define glGetAttribLocation GLEW_GET_FUN(__glewGetAttribLocation)
+#define glGetProgramInfoLog GLEW_GET_FUN(__glewGetProgramInfoLog)
+#define glGetProgramiv GLEW_GET_FUN(__glewGetProgramiv)
+#define glGetShaderInfoLog GLEW_GET_FUN(__glewGetShaderInfoLog)
+#define glGetShaderSource GLEW_GET_FUN(__glewGetShaderSource)
+#define glGetShaderiv GLEW_GET_FUN(__glewGetShaderiv)
+#define glGetUniformLocation GLEW_GET_FUN(__glewGetUniformLocation)
+#define glGetUniformfv GLEW_GET_FUN(__glewGetUniformfv)
+#define glGetUniformiv GLEW_GET_FUN(__glewGetUniformiv)
+#define glGetVertexAttribPointerv GLEW_GET_FUN(__glewGetVertexAttribPointerv)
+#define glGetVertexAttribdv GLEW_GET_FUN(__glewGetVertexAttribdv)
+#define glGetVertexAttribfv GLEW_GET_FUN(__glewGetVertexAttribfv)
+#define glGetVertexAttribiv GLEW_GET_FUN(__glewGetVertexAttribiv)
+#define glIsProgram GLEW_GET_FUN(__glewIsProgram)
+#define glIsShader GLEW_GET_FUN(__glewIsShader)
+#define glLinkProgram GLEW_GET_FUN(__glewLinkProgram)
+#define glShaderSource GLEW_GET_FUN(__glewShaderSource)
+#define glStencilFuncSeparate GLEW_GET_FUN(__glewStencilFuncSeparate)
+#define glStencilMaskSeparate GLEW_GET_FUN(__glewStencilMaskSeparate)
+#define glStencilOpSeparate GLEW_GET_FUN(__glewStencilOpSeparate)
+#define glUniform1f GLEW_GET_FUN(__glewUniform1f)
+#define glUniform1fv GLEW_GET_FUN(__glewUniform1fv)
+#define glUniform1i GLEW_GET_FUN(__glewUniform1i)
+#define glUniform1iv GLEW_GET_FUN(__glewUniform1iv)
+#define glUniform2f GLEW_GET_FUN(__glewUniform2f)
+#define glUniform2fv GLEW_GET_FUN(__glewUniform2fv)
+#define glUniform2i GLEW_GET_FUN(__glewUniform2i)
+#define glUniform2iv GLEW_GET_FUN(__glewUniform2iv)
+#define glUniform3f GLEW_GET_FUN(__glewUniform3f)
+#define glUniform3fv GLEW_GET_FUN(__glewUniform3fv)
+#define glUniform3i GLEW_GET_FUN(__glewUniform3i)
+#define glUniform3iv GLEW_GET_FUN(__glewUniform3iv)
+#define glUniform4f GLEW_GET_FUN(__glewUniform4f)
+#define glUniform4fv GLEW_GET_FUN(__glewUniform4fv)
+#define glUniform4i GLEW_GET_FUN(__glewUniform4i)
+#define glUniform4iv GLEW_GET_FUN(__glewUniform4iv)
+#define glUniformMatrix2fv GLEW_GET_FUN(__glewUniformMatrix2fv)
+#define glUniformMatrix3fv GLEW_GET_FUN(__glewUniformMatrix3fv)
+#define glUniformMatrix4fv GLEW_GET_FUN(__glewUniformMatrix4fv)
+#define glUseProgram GLEW_GET_FUN(__glewUseProgram)
+#define glValidateProgram GLEW_GET_FUN(__glewValidateProgram)
+#define glVertexAttrib1d GLEW_GET_FUN(__glewVertexAttrib1d)
+#define glVertexAttrib1dv GLEW_GET_FUN(__glewVertexAttrib1dv)
+#define glVertexAttrib1f GLEW_GET_FUN(__glewVertexAttrib1f)
+#define glVertexAttrib1fv GLEW_GET_FUN(__glewVertexAttrib1fv)
+#define glVertexAttrib1s GLEW_GET_FUN(__glewVertexAttrib1s)
+#define glVertexAttrib1sv GLEW_GET_FUN(__glewVertexAttrib1sv)
+#define glVertexAttrib2d GLEW_GET_FUN(__glewVertexAttrib2d)
+#define glVertexAttrib2dv GLEW_GET_FUN(__glewVertexAttrib2dv)
+#define glVertexAttrib2f GLEW_GET_FUN(__glewVertexAttrib2f)
+#define glVertexAttrib2fv GLEW_GET_FUN(__glewVertexAttrib2fv)
+#define glVertexAttrib2s GLEW_GET_FUN(__glewVertexAttrib2s)
+#define glVertexAttrib2sv GLEW_GET_FUN(__glewVertexAttrib2sv)
+#define glVertexAttrib3d GLEW_GET_FUN(__glewVertexAttrib3d)
+#define glVertexAttrib3dv GLEW_GET_FUN(__glewVertexAttrib3dv)
+#define glVertexAttrib3f GLEW_GET_FUN(__glewVertexAttrib3f)
+#define glVertexAttrib3fv GLEW_GET_FUN(__glewVertexAttrib3fv)
+#define glVertexAttrib3s GLEW_GET_FUN(__glewVertexAttrib3s)
+#define glVertexAttrib3sv GLEW_GET_FUN(__glewVertexAttrib3sv)
+#define glVertexAttrib4Nbv GLEW_GET_FUN(__glewVertexAttrib4Nbv)
+#define glVertexAttrib4Niv GLEW_GET_FUN(__glewVertexAttrib4Niv)
+#define glVertexAttrib4Nsv GLEW_GET_FUN(__glewVertexAttrib4Nsv)
+#define glVertexAttrib4Nub GLEW_GET_FUN(__glewVertexAttrib4Nub)
+#define glVertexAttrib4Nubv GLEW_GET_FUN(__glewVertexAttrib4Nubv)
+#define glVertexAttrib4Nuiv GLEW_GET_FUN(__glewVertexAttrib4Nuiv)
+#define glVertexAttrib4Nusv GLEW_GET_FUN(__glewVertexAttrib4Nusv)
+#define glVertexAttrib4bv GLEW_GET_FUN(__glewVertexAttrib4bv)
+#define glVertexAttrib4d GLEW_GET_FUN(__glewVertexAttrib4d)
+#define glVertexAttrib4dv GLEW_GET_FUN(__glewVertexAttrib4dv)
+#define glVertexAttrib4f GLEW_GET_FUN(__glewVertexAttrib4f)
+#define glVertexAttrib4fv GLEW_GET_FUN(__glewVertexAttrib4fv)
+#define glVertexAttrib4iv GLEW_GET_FUN(__glewVertexAttrib4iv)
+#define glVertexAttrib4s GLEW_GET_FUN(__glewVertexAttrib4s)
+#define glVertexAttrib4sv GLEW_GET_FUN(__glewVertexAttrib4sv)
+#define glVertexAttrib4ubv GLEW_GET_FUN(__glewVertexAttrib4ubv)
+#define glVertexAttrib4uiv GLEW_GET_FUN(__glewVertexAttrib4uiv)
+#define glVertexAttrib4usv GLEW_GET_FUN(__glewVertexAttrib4usv)
+#define glVertexAttribPointer GLEW_GET_FUN(__glewVertexAttribPointer)
+#endif /* GL_VERSION_2_0 */
+/* ----------------------------- GL_VERSION_2_1 ---------------------------- */
+#ifndef GL_VERSION_2_1
+#define GL_VERSION_2_1 1
+#define GL_FLOAT_MAT2x3 0x8B65
+#define GL_FLOAT_MAT2x4 0x8B66
+#define GL_FLOAT_MAT3x2 0x8B67
+#define GL_FLOAT_MAT3x4 0x8B68
+#define GL_FLOAT_MAT4x2 0x8B69
+#define GL_FLOAT_MAT4x3 0x8B6A
+#define GL_SRGB 0x8C40
+#define GL_SRGB8 0x8C41
+#define GL_SRGB_ALPHA 0x8C42
+#define GL_SRGB8_ALPHA8 0x8C43
+#define GL_SLUMINANCE8_ALPHA8 0x8C45
+#define GL_SLUMINANCE 0x8C46
+#define GL_SLUMINANCE8 0x8C47
+#define GL_COMPRESSED_SRGB 0x8C48
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2X3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2X4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3X2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3X4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4X2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4X3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+#define glUniformMatrix2x3fv GLEW_GET_FUN(__glewUniformMatrix2x3fv)
+#define glUniformMatrix2x4fv GLEW_GET_FUN(__glewUniformMatrix2x4fv)
+#define glUniformMatrix3x2fv GLEW_GET_FUN(__glewUniformMatrix3x2fv)
+#define glUniformMatrix3x4fv GLEW_GET_FUN(__glewUniformMatrix3x4fv)
+#define glUniformMatrix4x2fv GLEW_GET_FUN(__glewUniformMatrix4x2fv)
+#define glUniformMatrix4x3fv GLEW_GET_FUN(__glewUniformMatrix4x3fv)
+#endif /* GL_VERSION_2_1 */
+/* ----------------------------- GL_VERSION_3_0 ---------------------------- */
+#ifndef GL_VERSION_3_0
+#define GL_VERSION_3_0 1
+#define GL_MAJOR_VERSION 0x821B
+#define GL_MINOR_VERSION 0x821C
+#define GL_NUM_EXTENSIONS 0x821D
+#define GL_CONTEXT_FLAGS 0x821E
+#define GL_DEPTH_BUFFER 0x8223
+#define GL_STENCIL_BUFFER 0x8224
+#define GL_RGBA32F 0x8814
+#define GL_RGB32F 0x8815
+#define GL_RGBA16F 0x881A
+#define GL_RGB16F 0x881B
+#define GL_CLAMP_READ_COLOR 0x891C
+#define GL_FIXED_ONLY 0x891D
+#define GL_TEXTURE_RED_TYPE 0x8C10
+#define GL_TEXTURE_BLUE_TYPE 0x8C12
+#define GL_TEXTURE_1D_ARRAY 0x8C18
+#define GL_TEXTURE_2D_ARRAY 0x8C1A
+#define GL_R11F_G11F_B10F 0x8C3A
+#define GL_UNSIGNED_INT_10F_11F_11F_REV 0x8C3B
+#define GL_RGB9_E5 0x8C3D
+#define GL_UNSIGNED_INT_5_9_9_9_REV 0x8C3E
+#define GL_RGBA32UI 0x8D70
+#define GL_RGB32UI 0x8D71
+#define GL_RGBA16UI 0x8D76
+#define GL_RGB16UI 0x8D77
+#define GL_RGBA8UI 0x8D7C
+#define GL_RGB8UI 0x8D7D
+#define GL_RGBA32I 0x8D82
+#define GL_RGB32I 0x8D83
+#define GL_RGBA16I 0x8D88
+#define GL_RGB16I 0x8D89
+#define GL_RGBA8I 0x8D8E
+#define GL_RGB8I 0x8D8F
+#define GL_RED_INTEGER 0x8D94
+#define GL_GREEN_INTEGER 0x8D95
+#define GL_BLUE_INTEGER 0x8D96
+#define GL_ALPHA_INTEGER 0x8D97
+#define GL_RGB_INTEGER 0x8D98
+#define GL_RGBA_INTEGER 0x8D99
+#define GL_BGR_INTEGER 0x8D9A
+#define GL_BGRA_INTEGER 0x8D9B
+#define GL_SAMPLER_1D_ARRAY 0x8DC0
+#define GL_SAMPLER_2D_ARRAY 0x8DC1
+#define GL_UNSIGNED_INT_VEC2 0x8DC6
+#define GL_UNSIGNED_INT_VEC3 0x8DC7
+#define GL_UNSIGNED_INT_VEC4 0x8DC8
+#define GL_INT_SAMPLER_1D 0x8DC9
+#define GL_INT_SAMPLER_2D 0x8DCA
+#define GL_INT_SAMPLER_3D 0x8DCB
+#define GL_QUERY_WAIT 0x8E13
+#define GL_QUERY_NO_WAIT 0x8E14
+typedef void (GLAPIENTRY * PFNGLBINDFRAGDATALOCATIONPROC) (GLuint program, GLuint colorNumber, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLCLAMPCOLORPROC) (GLenum target, GLenum clamp);
+typedef void (GLAPIENTRY * PFNGLCLEARBUFFERFIPROC) (GLenum buffer, GLint drawBuffer, GLfloat depth, GLint stencil);
+typedef void (GLAPIENTRY * PFNGLCLEARBUFFERFVPROC) (GLenum buffer, GLint drawBuffer, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLCLEARBUFFERIVPROC) (GLenum buffer, GLint drawBuffer, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLCLEARBUFFERUIVPROC) (GLenum buffer, GLint drawBuffer, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLCOLORMASKIPROC) (GLuint buf, GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha);
+typedef void (GLAPIENTRY * PFNGLDISABLEIPROC) (GLenum cap, GLuint index);
+typedef void (GLAPIENTRY * PFNGLENABLEIPROC) (GLenum cap, GLuint index);
+typedef void (GLAPIENTRY * PFNGLGETBOOLEANI_VPROC) (GLenum pname, GLuint index, GLboolean* data);
+typedef GLint (GLAPIENTRY * PFNGLGETFRAGDATALOCATIONPROC) (GLuint program, const GLchar* name);
+typedef const GLubyte* (GLAPIENTRY * PFNGLGETSTRINGIPROC) (GLenum name, GLuint index);
+typedef void (GLAPIENTRY * PFNGLGETTEXPARAMETERIIVPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXPARAMETERIUIVPROC) (GLenum target, GLenum pname, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETTRANSFORMFEEDBACKVARYINGPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei * length, GLsizei * size, GLenum * type, GLchar * name);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMUIVPROC) (GLuint program, GLint location, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBIIVPROC) (GLuint index, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBIUIVPROC) (GLuint index, GLenum pname, GLuint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISENABLEDIPROC) (GLenum cap, GLuint index);
+typedef void (GLAPIENTRY * PFNGLTEXPARAMETERIIVPROC) (GLenum target, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLTEXPARAMETERIUIVPROC) (GLenum target, GLenum pname, const GLuint* params);
+typedef void (GLAPIENTRY * PFNGLTRANSFORMFEEDBACKVARYINGSPROC) (GLuint program, GLsizei count, const GLchar *const* varyings, GLenum bufferMode);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1UIPROC) (GLint location, GLuint v0);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1UIVPROC) (GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2UIPROC) (GLint location, GLuint v0, GLuint v1);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2UIVPROC) (GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3UIPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3UIVPROC) (GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4UIPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4UIVPROC) (GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI1IPROC) (GLuint index, GLint v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI1IVPROC) (GLuint index, const GLint* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI1UIPROC) (GLuint index, GLuint v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI1UIVPROC) (GLuint index, const GLuint* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI2IPROC) (GLuint index, GLint v0, GLint v1);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI2IVPROC) (GLuint index, const GLint* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI2UIPROC) (GLuint index, GLuint v0, GLuint v1);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI2UIVPROC) (GLuint index, const GLuint* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI3IPROC) (GLuint index, GLint v0, GLint v1, GLint v2);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI3IVPROC) (GLuint index, const GLint* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI3UIPROC) (GLuint index, GLuint v0, GLuint v1, GLuint v2);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI3UIVPROC) (GLuint index, const GLuint* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI4BVPROC) (GLuint index, const GLbyte* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI4IPROC) (GLuint index, GLint v0, GLint v1, GLint v2, GLint v3);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI4IVPROC) (GLuint index, const GLint* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI4SVPROC) (GLuint index, const GLshort* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI4UBVPROC) (GLuint index, const GLubyte* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI4UIPROC) (GLuint index, GLuint v0, GLuint v1, GLuint v2, GLuint v3);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI4UIVPROC) (GLuint index, const GLuint* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI4USVPROC) (GLuint index, const GLushort* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBIPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void*pointer);
+#define glBeginConditionalRender GLEW_GET_FUN(__glewBeginConditionalRender)
+#define glBeginTransformFeedback GLEW_GET_FUN(__glewBeginTransformFeedback)
+#define glBindFragDataLocation GLEW_GET_FUN(__glewBindFragDataLocation)
+#define glClampColor GLEW_GET_FUN(__glewClampColor)
+#define glClearBufferfi GLEW_GET_FUN(__glewClearBufferfi)
+#define glClearBufferfv GLEW_GET_FUN(__glewClearBufferfv)
+#define glClearBufferiv GLEW_GET_FUN(__glewClearBufferiv)
+#define glClearBufferuiv GLEW_GET_FUN(__glewClearBufferuiv)
+#define glColorMaski GLEW_GET_FUN(__glewColorMaski)
+#define glDisablei GLEW_GET_FUN(__glewDisablei)
+#define glEnablei GLEW_GET_FUN(__glewEnablei)
+#define glEndConditionalRender GLEW_GET_FUN(__glewEndConditionalRender)
+#define glEndTransformFeedback GLEW_GET_FUN(__glewEndTransformFeedback)
+#define glGetBooleani_v GLEW_GET_FUN(__glewGetBooleani_v)
+#define glGetFragDataLocation GLEW_GET_FUN(__glewGetFragDataLocation)
+#define glGetStringi GLEW_GET_FUN(__glewGetStringi)
+#define glGetTexParameterIiv GLEW_GET_FUN(__glewGetTexParameterIiv)
+#define glGetTexParameterIuiv GLEW_GET_FUN(__glewGetTexParameterIuiv)
+#define glGetTransformFeedbackVarying GLEW_GET_FUN(__glewGetTransformFeedbackVarying)
+#define glGetUniformuiv GLEW_GET_FUN(__glewGetUniformuiv)
+#define glGetVertexAttribIiv GLEW_GET_FUN(__glewGetVertexAttribIiv)
+#define glGetVertexAttribIuiv GLEW_GET_FUN(__glewGetVertexAttribIuiv)
+#define glIsEnabledi GLEW_GET_FUN(__glewIsEnabledi)
+#define glTexParameterIiv GLEW_GET_FUN(__glewTexParameterIiv)
+#define glTexParameterIuiv GLEW_GET_FUN(__glewTexParameterIuiv)
+#define glTransformFeedbackVaryings GLEW_GET_FUN(__glewTransformFeedbackVaryings)
+#define glUniform1ui GLEW_GET_FUN(__glewUniform1ui)
+#define glUniform1uiv GLEW_GET_FUN(__glewUniform1uiv)
+#define glUniform2ui GLEW_GET_FUN(__glewUniform2ui)
+#define glUniform2uiv GLEW_GET_FUN(__glewUniform2uiv)
+#define glUniform3ui GLEW_GET_FUN(__glewUniform3ui)
+#define glUniform3uiv GLEW_GET_FUN(__glewUniform3uiv)
+#define glUniform4ui GLEW_GET_FUN(__glewUniform4ui)
+#define glUniform4uiv GLEW_GET_FUN(__glewUniform4uiv)
+#define glVertexAttribI1i GLEW_GET_FUN(__glewVertexAttribI1i)
+#define glVertexAttribI1iv GLEW_GET_FUN(__glewVertexAttribI1iv)
+#define glVertexAttribI1ui GLEW_GET_FUN(__glewVertexAttribI1ui)
+#define glVertexAttribI1uiv GLEW_GET_FUN(__glewVertexAttribI1uiv)
+#define glVertexAttribI2i GLEW_GET_FUN(__glewVertexAttribI2i)
+#define glVertexAttribI2iv GLEW_GET_FUN(__glewVertexAttribI2iv)
+#define glVertexAttribI2ui GLEW_GET_FUN(__glewVertexAttribI2ui)
+#define glVertexAttribI2uiv GLEW_GET_FUN(__glewVertexAttribI2uiv)
+#define glVertexAttribI3i GLEW_GET_FUN(__glewVertexAttribI3i)
+#define glVertexAttribI3iv GLEW_GET_FUN(__glewVertexAttribI3iv)
+#define glVertexAttribI3ui GLEW_GET_FUN(__glewVertexAttribI3ui)
+#define glVertexAttribI3uiv GLEW_GET_FUN(__glewVertexAttribI3uiv)
+#define glVertexAttribI4bv GLEW_GET_FUN(__glewVertexAttribI4bv)
+#define glVertexAttribI4i GLEW_GET_FUN(__glewVertexAttribI4i)
+#define glVertexAttribI4iv GLEW_GET_FUN(__glewVertexAttribI4iv)
+#define glVertexAttribI4sv GLEW_GET_FUN(__glewVertexAttribI4sv)
+#define glVertexAttribI4ubv GLEW_GET_FUN(__glewVertexAttribI4ubv)
+#define glVertexAttribI4ui GLEW_GET_FUN(__glewVertexAttribI4ui)
+#define glVertexAttribI4uiv GLEW_GET_FUN(__glewVertexAttribI4uiv)
+#define glVertexAttribI4usv GLEW_GET_FUN(__glewVertexAttribI4usv)
+#define glVertexAttribIPointer GLEW_GET_FUN(__glewVertexAttribIPointer)
+#endif /* GL_VERSION_3_0 */
+/* ----------------------------- GL_VERSION_3_1 ---------------------------- */
+#ifndef GL_VERSION_3_1
+#define GL_VERSION_3_1 1
+#define GL_SAMPLER_2D_RECT 0x8B63
+#define GL_RED_SNORM 0x8F90
+#define GL_RG_SNORM 0x8F91
+#define GL_RGB_SNORM 0x8F92
+#define GL_RGBA_SNORM 0x8F93
+#define GL_R8_SNORM 0x8F94
+#define GL_RG8_SNORM 0x8F95
+#define GL_RGB8_SNORM 0x8F96
+#define GL_RGBA8_SNORM 0x8F97
+#define GL_R16_SNORM 0x8F98
+#define GL_RG16_SNORM 0x8F99
+#define GL_RGB16_SNORM 0x8F9A
+#define GL_RGBA16_SNORM 0x8F9B
+#define GL_BUFFER_MAP_LENGTH 0x9120
+#define GL_BUFFER_MAP_OFFSET 0x9121
+typedef void (GLAPIENTRY * PFNGLDRAWARRAYSINSTANCEDPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDPROC) (GLenum mode, GLsizei count, GLenum type, const void* indices, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLTEXBUFFERPROC) (GLenum target, GLenum internalFormat, GLuint buffer);
+#define glDrawArraysInstanced GLEW_GET_FUN(__glewDrawArraysInstanced)
+#define glDrawElementsInstanced GLEW_GET_FUN(__glewDrawElementsInstanced)
+#define glPrimitiveRestartIndex GLEW_GET_FUN(__glewPrimitiveRestartIndex)
+#define glTexBuffer GLEW_GET_FUN(__glewTexBuffer)
+#endif /* GL_VERSION_3_1 */
+/* ----------------------------- GL_VERSION_3_2 ---------------------------- */
+#ifndef GL_VERSION_3_2
+#define GL_VERSION_3_2 1
+#define GL_CONTEXT_CORE_PROFILE_BIT 0x00000001
+#define GL_LINES_ADJACENCY 0x000A
+#define GL_PROGRAM_POINT_SIZE 0x8642
+#define GL_GEOMETRY_INPUT_TYPE 0x8917
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTUREPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERPARAMETERI64VPROC) (GLenum target, GLenum value, GLint64 * data);
+typedef void (GLAPIENTRY * PFNGLGETINTEGER64I_VPROC) (GLenum pname, GLuint index, GLint64 * data);
+#define glFramebufferTexture GLEW_GET_FUN(__glewFramebufferTexture)
+#define glGetBufferParameteri64v GLEW_GET_FUN(__glewGetBufferParameteri64v)
+#define glGetInteger64i_v GLEW_GET_FUN(__glewGetInteger64i_v)
+#endif /* GL_VERSION_3_2 */
+/* ----------------------------- GL_VERSION_3_3 ---------------------------- */
+#ifndef GL_VERSION_3_3
+#define GL_VERSION_3_3 1
+#define GL_RGB10_A2UI 0x906F
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBDIVISORPROC) (GLuint index, GLuint divisor);
+#define glVertexAttribDivisor GLEW_GET_FUN(__glewVertexAttribDivisor)
+#endif /* GL_VERSION_3_3 */
+/* ----------------------------- GL_VERSION_4_0 ---------------------------- */
+#ifndef GL_VERSION_4_0
+#define GL_VERSION_4_0 1
+#define GL_SAMPLE_SHADING 0x8C36
+typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONSEPARATEIPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha);
+typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONIPROC) (GLuint buf, GLenum mode);
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCSEPARATEIPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha);
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCIPROC) (GLuint buf, GLenum src, GLenum dst);
+#define glBlendEquationSeparatei GLEW_GET_FUN(__glewBlendEquationSeparatei)
+#define glBlendEquationi GLEW_GET_FUN(__glewBlendEquationi)
+#define glBlendFuncSeparatei GLEW_GET_FUN(__glewBlendFuncSeparatei)
+#define glBlendFunci GLEW_GET_FUN(__glewBlendFunci)
+#define glMinSampleShading GLEW_GET_FUN(__glewMinSampleShading)
+#endif /* GL_VERSION_4_0 */
+/* ----------------------------- GL_VERSION_4_1 ---------------------------- */
+#ifndef GL_VERSION_4_1
+#define GL_VERSION_4_1 1
+#endif /* GL_VERSION_4_1 */
+/* ----------------------------- GL_VERSION_4_2 ---------------------------- */
+#ifndef GL_VERSION_4_2
+#define GL_VERSION_4_2 1
+#endif /* GL_VERSION_4_2 */
+/* ----------------------------- GL_VERSION_4_3 ---------------------------- */
+#ifndef GL_VERSION_4_3
+#define GL_VERSION_4_3 1
+#endif /* GL_VERSION_4_3 */
+/* ----------------------------- GL_VERSION_4_4 ---------------------------- */
+#ifndef GL_VERSION_4_4
+#define GL_VERSION_4_4 1
+#endif /* GL_VERSION_4_4 */
+/* ----------------------------- GL_VERSION_4_5 ---------------------------- */
+#ifndef GL_VERSION_4_5
+#define GL_VERSION_4_5 1
+typedef void (GLAPIENTRY * PFNGLGETNCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint lod, GLsizei bufSize, GLvoid *pixels);
+typedef void (GLAPIENTRY * PFNGLGETNTEXIMAGEPROC) (GLenum tex, GLint level, GLenum format, GLenum type, GLsizei bufSize, GLvoid *pixels);
+typedef void (GLAPIENTRY * PFNGLGETNUNIFORMDVPROC) (GLuint program, GLint location, GLsizei bufSize, GLdouble *params);
+#define glGetGraphicsResetStatus GLEW_GET_FUN(__glewGetGraphicsResetStatus)
+#define glGetnCompressedTexImage GLEW_GET_FUN(__glewGetnCompressedTexImage)
+#define glGetnTexImage GLEW_GET_FUN(__glewGetnTexImage)
+#define glGetnUniformdv GLEW_GET_FUN(__glewGetnUniformdv)
+#endif /* GL_VERSION_4_5 */
+/* ----------------------------- GL_VERSION_4_6 ---------------------------- */
+#ifndef GL_VERSION_4_6
+#define GL_VERSION_4_6 1
+#define GL_CONTEXT_FLAG_NO_ERROR_BIT 0x00000008
+#define GL_SPIR_V_BINARY 0x9552
+#define GL_SPIR_V_EXTENSIONS 0x9553
+#define GL_NUM_SPIR_V_EXTENSIONS 0x9554
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWARRAYSINDIRECTCOUNTPROC) (GLenum mode, const GLvoid *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTPROC) (GLenum mode, GLenum type, const GLvoid *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride);
+typedef void (GLAPIENTRY * PFNGLSPECIALIZESHADERPROC) (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue);
+#define glMultiDrawArraysIndirectCount GLEW_GET_FUN(__glewMultiDrawArraysIndirectCount)
+#define glMultiDrawElementsIndirectCount GLEW_GET_FUN(__glewMultiDrawElementsIndirectCount)
+#define glSpecializeShader GLEW_GET_FUN(__glewSpecializeShader)
+#endif /* GL_VERSION_4_6 */
+/* -------------------------- GL_3DFX_multisample -------------------------- */
+#ifndef GL_3DFX_multisample
+#define GL_3DFX_multisample 1
+#define GL_MULTISAMPLE_3DFX 0x86B2
+#define GL_SAMPLE_BUFFERS_3DFX 0x86B3
+#define GL_SAMPLES_3DFX 0x86B4
+#define GL_MULTISAMPLE_BIT_3DFX 0x20000000
+#define GLEW_3DFX_multisample GLEW_GET_VAR(__GLEW_3DFX_multisample)
+#endif /* GL_3DFX_multisample */
+/* ---------------------------- GL_3DFX_tbuffer ---------------------------- */
+#ifndef GL_3DFX_tbuffer
+#define GL_3DFX_tbuffer 1
+#define glTbufferMask3DFX GLEW_GET_FUN(__glewTbufferMask3DFX)
+#define GLEW_3DFX_tbuffer GLEW_GET_VAR(__GLEW_3DFX_tbuffer)
+#endif /* GL_3DFX_tbuffer */
+/* -------------------- GL_3DFX_texture_compression_FXT1 ------------------- */
+#ifndef GL_3DFX_texture_compression_FXT1
+#define GL_3DFX_texture_compression_FXT1 1
+#define GLEW_3DFX_texture_compression_FXT1 GLEW_GET_VAR(__GLEW_3DFX_texture_compression_FXT1)
+#endif /* GL_3DFX_texture_compression_FXT1 */
+/* ----------------------- GL_AMD_blend_minmax_factor ---------------------- */
+#ifndef GL_AMD_blend_minmax_factor
+#define GL_AMD_blend_minmax_factor 1
+#define GL_FACTOR_MIN_AMD 0x901C
+#define GL_FACTOR_MAX_AMD 0x901D
+#define GLEW_AMD_blend_minmax_factor GLEW_GET_VAR(__GLEW_AMD_blend_minmax_factor)
+#endif /* GL_AMD_blend_minmax_factor */
+/* --------------------- GL_AMD_compressed_3DC_texture --------------------- */
+#ifndef GL_AMD_compressed_3DC_texture
+#define GL_AMD_compressed_3DC_texture 1
+#define GL_3DC_X_AMD 0x87F9
+#define GL_3DC_XY_AMD 0x87FA
+#define GLEW_AMD_compressed_3DC_texture GLEW_GET_VAR(__GLEW_AMD_compressed_3DC_texture)
+#endif /* GL_AMD_compressed_3DC_texture */
+/* --------------------- GL_AMD_compressed_ATC_texture --------------------- */
+#ifndef GL_AMD_compressed_ATC_texture
+#define GL_AMD_compressed_ATC_texture 1
+#define GL_ATC_RGB_AMD 0x8C92
+#define GLEW_AMD_compressed_ATC_texture GLEW_GET_VAR(__GLEW_AMD_compressed_ATC_texture)
+#endif /* GL_AMD_compressed_ATC_texture */
+/* ----------------------- GL_AMD_conservative_depth ----------------------- */
+#ifndef GL_AMD_conservative_depth
+#define GL_AMD_conservative_depth 1
+#define GLEW_AMD_conservative_depth GLEW_GET_VAR(__GLEW_AMD_conservative_depth)
+#endif /* GL_AMD_conservative_depth */
+/* -------------------------- GL_AMD_debug_output -------------------------- */
+#ifndef GL_AMD_debug_output
+#define GL_AMD_debug_output 1
+typedef void (GLAPIENTRY *GLDEBUGPROCAMD)(GLuint id, GLenum category, GLenum severity, GLsizei length, const GLchar* message, void* userParam);
+typedef void (GLAPIENTRY * PFNGLDEBUGMESSAGEENABLEAMDPROC) (GLenum category, GLenum severity, GLsizei count, const GLuint* ids, GLboolean enabled);
+typedef void (GLAPIENTRY * PFNGLDEBUGMESSAGEINSERTAMDPROC) (GLenum category, GLenum severity, GLuint id, GLsizei length, const GLchar* buf);
+typedef GLuint (GLAPIENTRY * PFNGLGETDEBUGMESSAGELOGAMDPROC) (GLuint count, GLsizei bufsize, GLenum* categories, GLuint* severities, GLuint* ids, GLsizei* lengths, GLchar* message);
+#define glDebugMessageCallbackAMD GLEW_GET_FUN(__glewDebugMessageCallbackAMD)
+#define glDebugMessageEnableAMD GLEW_GET_FUN(__glewDebugMessageEnableAMD)
+#define glDebugMessageInsertAMD GLEW_GET_FUN(__glewDebugMessageInsertAMD)
+#define glGetDebugMessageLogAMD GLEW_GET_FUN(__glewGetDebugMessageLogAMD)
+#define GLEW_AMD_debug_output GLEW_GET_VAR(__GLEW_AMD_debug_output)
+#endif /* GL_AMD_debug_output */
+/* ---------------------- GL_AMD_depth_clamp_separate ---------------------- */
+#ifndef GL_AMD_depth_clamp_separate
+#define GL_AMD_depth_clamp_separate 1
+#define GL_DEPTH_CLAMP_FAR_AMD 0x901F
+#define GLEW_AMD_depth_clamp_separate GLEW_GET_VAR(__GLEW_AMD_depth_clamp_separate)
+#endif /* GL_AMD_depth_clamp_separate */
+/* ----------------------- GL_AMD_draw_buffers_blend ----------------------- */
+#ifndef GL_AMD_draw_buffers_blend
+#define GL_AMD_draw_buffers_blend 1
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCINDEXEDAMDPROC) (GLuint buf, GLenum src, GLenum dst);
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCSEPARATEINDEXEDAMDPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha);
+#define glBlendEquationIndexedAMD GLEW_GET_FUN(__glewBlendEquationIndexedAMD)
+#define glBlendEquationSeparateIndexedAMD GLEW_GET_FUN(__glewBlendEquationSeparateIndexedAMD)
+#define glBlendFuncIndexedAMD GLEW_GET_FUN(__glewBlendFuncIndexedAMD)
+#define glBlendFuncSeparateIndexedAMD GLEW_GET_FUN(__glewBlendFuncSeparateIndexedAMD)
+#define GLEW_AMD_draw_buffers_blend GLEW_GET_VAR(__GLEW_AMD_draw_buffers_blend)
+#endif /* GL_AMD_draw_buffers_blend */
+/* ------------------ GL_AMD_framebuffer_sample_positions ------------------ */
+#ifndef GL_AMD_framebuffer_sample_positions
+#define GL_AMD_framebuffer_sample_positions 1
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERSAMPLEPOSITIONSFVAMDPROC) (GLenum target, GLuint numsamples, GLuint pixelindex, const GLfloat* values);
+typedef void (GLAPIENTRY * PFNGLGETFRAMEBUFFERPARAMETERFVAMDPROC) (GLenum target, GLenum pname, GLuint numsamples, GLuint pixelindex, GLsizei size, GLfloat* values);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDFRAMEBUFFERPARAMETERFVAMDPROC) (GLuint framebuffer, GLenum pname, GLuint numsamples, GLuint pixelindex, GLsizei size, GLfloat* values);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERSAMPLEPOSITIONSFVAMDPROC) (GLuint framebuffer, GLuint numsamples, GLuint pixelindex, const GLfloat* values);
+#define glFramebufferSamplePositionsfvAMD GLEW_GET_FUN(__glewFramebufferSamplePositionsfvAMD)
+#define glGetFramebufferParameterfvAMD GLEW_GET_FUN(__glewGetFramebufferParameterfvAMD)
+#define glGetNamedFramebufferParameterfvAMD GLEW_GET_FUN(__glewGetNamedFramebufferParameterfvAMD)
+#define glNamedFramebufferSamplePositionsfvAMD GLEW_GET_FUN(__glewNamedFramebufferSamplePositionsfvAMD)
+#define GLEW_AMD_framebuffer_sample_positions GLEW_GET_VAR(__GLEW_AMD_framebuffer_sample_positions)
+#endif /* GL_AMD_framebuffer_sample_positions */
+/* --------------------------- GL_AMD_gcn_shader --------------------------- */
+#ifndef GL_AMD_gcn_shader
+#define GL_AMD_gcn_shader 1
+#define GLEW_AMD_gcn_shader GLEW_GET_VAR(__GLEW_AMD_gcn_shader)
+#endif /* GL_AMD_gcn_shader */
+/* ---------------------- GL_AMD_gpu_shader_half_float --------------------- */
+#ifndef GL_AMD_gpu_shader_half_float
+#define GL_AMD_gpu_shader_half_float 1
+#define GL_FLOAT16_NV 0x8FF8
+#define GL_FLOAT16_VEC2_NV 0x8FF9
+#define GL_FLOAT16_VEC3_NV 0x8FFA
+#define GL_FLOAT16_VEC4_NV 0x8FFB
+#define GL_FLOAT16_MAT2_AMD 0x91C5
+#define GL_FLOAT16_MAT3_AMD 0x91C6
+#define GL_FLOAT16_MAT4_AMD 0x91C7
+#define GL_FLOAT16_MAT2x3_AMD 0x91C8
+#define GL_FLOAT16_MAT2x4_AMD 0x91C9
+#define GL_FLOAT16_MAT3x2_AMD 0x91CA
+#define GL_FLOAT16_MAT3x4_AMD 0x91CB
+#define GL_FLOAT16_MAT4x2_AMD 0x91CC
+#define GL_FLOAT16_MAT4x3_AMD 0x91CD
+#define GLEW_AMD_gpu_shader_half_float GLEW_GET_VAR(__GLEW_AMD_gpu_shader_half_float)
+#endif /* GL_AMD_gpu_shader_half_float */
+/* ------------------------ GL_AMD_gpu_shader_int16 ------------------------ */
+#ifndef GL_AMD_gpu_shader_int16
+#define GL_AMD_gpu_shader_int16 1
+#define GLEW_AMD_gpu_shader_int16 GLEW_GET_VAR(__GLEW_AMD_gpu_shader_int16)
+#endif /* GL_AMD_gpu_shader_int16 */
+/* ------------------------ GL_AMD_gpu_shader_int64 ------------------------ */
+#ifndef GL_AMD_gpu_shader_int64
+#define GL_AMD_gpu_shader_int64 1
+#define GLEW_AMD_gpu_shader_int64 GLEW_GET_VAR(__GLEW_AMD_gpu_shader_int64)
+#endif /* GL_AMD_gpu_shader_int64 */
+/* ---------------------- GL_AMD_interleaved_elements ---------------------- */
+#ifndef GL_AMD_interleaved_elements
+#define GL_AMD_interleaved_elements 1
+#define GL_RED 0x1903
+#define GL_GREEN 0x1904
+#define GL_BLUE 0x1905
+#define GL_ALPHA 0x1906
+#define GL_RG8UI 0x8238
+#define GL_RG16UI 0x823A
+#define GL_RGBA8UI 0x8D7C
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBPARAMETERIAMDPROC) (GLuint index, GLenum pname, GLint param);
+#define glVertexAttribParameteriAMD GLEW_GET_FUN(__glewVertexAttribParameteriAMD)
+#define GLEW_AMD_interleaved_elements GLEW_GET_VAR(__GLEW_AMD_interleaved_elements)
+#endif /* GL_AMD_interleaved_elements */
+/* ----------------------- GL_AMD_multi_draw_indirect ---------------------- */
+#ifndef GL_AMD_multi_draw_indirect
+#define GL_AMD_multi_draw_indirect 1
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWARRAYSINDIRECTAMDPROC) (GLenum mode, const void *indirect, GLsizei primcount, GLsizei stride);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSINDIRECTAMDPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei primcount, GLsizei stride);
+#define glMultiDrawArraysIndirectAMD GLEW_GET_FUN(__glewMultiDrawArraysIndirectAMD)
+#define glMultiDrawElementsIndirectAMD GLEW_GET_FUN(__glewMultiDrawElementsIndirectAMD)
+#define GLEW_AMD_multi_draw_indirect GLEW_GET_VAR(__GLEW_AMD_multi_draw_indirect)
+#endif /* GL_AMD_multi_draw_indirect */
+/* ------------------------- GL_AMD_name_gen_delete ------------------------ */
+#ifndef GL_AMD_name_gen_delete
+#define GL_AMD_name_gen_delete 1
+#define GL_DATA_BUFFER_AMD 0x9151
+#define GL_QUERY_OBJECT_AMD 0x9153
+#define GL_SAMPLER_OBJECT_AMD 0x9155
+typedef void (GLAPIENTRY * PFNGLDELETENAMESAMDPROC) (GLenum identifier, GLuint num, const GLuint* names);
+typedef void (GLAPIENTRY * PFNGLGENNAMESAMDPROC) (GLenum identifier, GLuint num, GLuint* names);
+typedef GLboolean (GLAPIENTRY * PFNGLISNAMEAMDPROC) (GLenum identifier, GLuint name);
+#define glDeleteNamesAMD GLEW_GET_FUN(__glewDeleteNamesAMD)
+#define glGenNamesAMD GLEW_GET_FUN(__glewGenNamesAMD)
+#define glIsNameAMD GLEW_GET_FUN(__glewIsNameAMD)
+#define GLEW_AMD_name_gen_delete GLEW_GET_VAR(__GLEW_AMD_name_gen_delete)
+#endif /* GL_AMD_name_gen_delete */
+/* ---------------------- GL_AMD_occlusion_query_event --------------------- */
+#ifndef GL_AMD_occlusion_query_event
+#define GL_AMD_occlusion_query_event 1
+typedef void (GLAPIENTRY * PFNGLQUERYOBJECTPARAMETERUIAMDPROC) (GLenum target, GLuint id, GLenum pname, GLuint param);
+#define glQueryObjectParameteruiAMD GLEW_GET_FUN(__glewQueryObjectParameteruiAMD)
+#define GLEW_AMD_occlusion_query_event GLEW_GET_VAR(__GLEW_AMD_occlusion_query_event)
+#endif /* GL_AMD_occlusion_query_event */
+/* ----------------------- GL_AMD_performance_monitor ---------------------- */
+#ifndef GL_AMD_performance_monitor
+#define GL_AMD_performance_monitor 1
+#define GL_UNSIGNED_INT64_AMD 0x8BC2
+typedef void (GLAPIENTRY * PFNGLDELETEPERFMONITORSAMDPROC) (GLsizei n, GLuint* monitors);
+typedef void (GLAPIENTRY * PFNGLGENPERFMONITORSAMDPROC) (GLsizei n, GLuint* monitors);
+typedef void (GLAPIENTRY * PFNGLGETPERFMONITORCOUNTERDATAAMDPROC) (GLuint monitor, GLenum pname, GLsizei dataSize, GLuint* data, GLint *bytesWritten);
+typedef void (GLAPIENTRY * PFNGLGETPERFMONITORCOUNTERINFOAMDPROC) (GLuint group, GLuint counter, GLenum pname, void *data);
+typedef void (GLAPIENTRY * PFNGLGETPERFMONITORCOUNTERSTRINGAMDPROC) (GLuint group, GLuint counter, GLsizei bufSize, GLsizei* length, GLchar *counterString);
+typedef void (GLAPIENTRY * PFNGLGETPERFMONITORCOUNTERSAMDPROC) (GLuint group, GLint* numCounters, GLint *maxActiveCounters, GLsizei countersSize, GLuint *counters);
+typedef void (GLAPIENTRY * PFNGLGETPERFMONITORGROUPSTRINGAMDPROC) (GLuint group, GLsizei bufSize, GLsizei* length, GLchar *groupString);
+typedef void (GLAPIENTRY * PFNGLGETPERFMONITORGROUPSAMDPROC) (GLint* numGroups, GLsizei groupsSize, GLuint *groups);
+typedef void (GLAPIENTRY * PFNGLSELECTPERFMONITORCOUNTERSAMDPROC) (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint* counterList);
+#define glBeginPerfMonitorAMD GLEW_GET_FUN(__glewBeginPerfMonitorAMD)
+#define glDeletePerfMonitorsAMD GLEW_GET_FUN(__glewDeletePerfMonitorsAMD)
+#define glEndPerfMonitorAMD GLEW_GET_FUN(__glewEndPerfMonitorAMD)
+#define glGenPerfMonitorsAMD GLEW_GET_FUN(__glewGenPerfMonitorsAMD)
+#define glGetPerfMonitorCounterDataAMD GLEW_GET_FUN(__glewGetPerfMonitorCounterDataAMD)
+#define glGetPerfMonitorCounterInfoAMD GLEW_GET_FUN(__glewGetPerfMonitorCounterInfoAMD)
+#define glGetPerfMonitorCounterStringAMD GLEW_GET_FUN(__glewGetPerfMonitorCounterStringAMD)
+#define glGetPerfMonitorCountersAMD GLEW_GET_FUN(__glewGetPerfMonitorCountersAMD)
+#define glGetPerfMonitorGroupStringAMD GLEW_GET_FUN(__glewGetPerfMonitorGroupStringAMD)
+#define glGetPerfMonitorGroupsAMD GLEW_GET_FUN(__glewGetPerfMonitorGroupsAMD)
+#define glSelectPerfMonitorCountersAMD GLEW_GET_FUN(__glewSelectPerfMonitorCountersAMD)
+#define GLEW_AMD_performance_monitor GLEW_GET_VAR(__GLEW_AMD_performance_monitor)
+#endif /* GL_AMD_performance_monitor */
+/* -------------------------- GL_AMD_pinned_memory ------------------------- */
+#ifndef GL_AMD_pinned_memory
+#define GL_AMD_pinned_memory 1
+#define GLEW_AMD_pinned_memory GLEW_GET_VAR(__GLEW_AMD_pinned_memory)
+#endif /* GL_AMD_pinned_memory */
+/* ----------------------- GL_AMD_program_binary_Z400 ---------------------- */
+#ifndef GL_AMD_program_binary_Z400
+#define GL_AMD_program_binary_Z400 1
+#define GL_Z400_BINARY_AMD 0x8740
+#define GLEW_AMD_program_binary_Z400 GLEW_GET_VAR(__GLEW_AMD_program_binary_Z400)
+#endif /* GL_AMD_program_binary_Z400 */
+/* ----------------------- GL_AMD_query_buffer_object ---------------------- */
+#ifndef GL_AMD_query_buffer_object
+#define GL_AMD_query_buffer_object 1
+#define GL_QUERY_BUFFER_AMD 0x9192
+#define GLEW_AMD_query_buffer_object GLEW_GET_VAR(__GLEW_AMD_query_buffer_object)
+#endif /* GL_AMD_query_buffer_object */
+/* ------------------------ GL_AMD_sample_positions ------------------------ */
+#ifndef GL_AMD_sample_positions
+#define GL_AMD_sample_positions 1
+typedef void (GLAPIENTRY * PFNGLSETMULTISAMPLEFVAMDPROC) (GLenum pname, GLuint index, const GLfloat* val);
+#define glSetMultisamplefvAMD GLEW_GET_FUN(__glewSetMultisamplefvAMD)
+#define GLEW_AMD_sample_positions GLEW_GET_VAR(__GLEW_AMD_sample_positions)
+#endif /* GL_AMD_sample_positions */
+/* ------------------ GL_AMD_seamless_cubemap_per_texture ------------------ */
+#ifndef GL_AMD_seamless_cubemap_per_texture
+#define GL_AMD_seamless_cubemap_per_texture 1
+#define GLEW_AMD_seamless_cubemap_per_texture GLEW_GET_VAR(__GLEW_AMD_seamless_cubemap_per_texture)
+#endif /* GL_AMD_seamless_cubemap_per_texture */
+/* -------------------- GL_AMD_shader_atomic_counter_ops ------------------- */
+#ifndef GL_AMD_shader_atomic_counter_ops
+#define GL_AMD_shader_atomic_counter_ops 1
+#define GLEW_AMD_shader_atomic_counter_ops GLEW_GET_VAR(__GLEW_AMD_shader_atomic_counter_ops)
+#endif /* GL_AMD_shader_atomic_counter_ops */
+/* -------------------------- GL_AMD_shader_ballot ------------------------- */
+#ifndef GL_AMD_shader_ballot
+#define GL_AMD_shader_ballot 1
+#define GLEW_AMD_shader_ballot GLEW_GET_VAR(__GLEW_AMD_shader_ballot)
+#endif /* GL_AMD_shader_ballot */
+/* ---------------- GL_AMD_shader_explicit_vertex_parameter ---------------- */
+#ifndef GL_AMD_shader_explicit_vertex_parameter
+#define GL_AMD_shader_explicit_vertex_parameter 1
+#define GLEW_AMD_shader_explicit_vertex_parameter GLEW_GET_VAR(__GLEW_AMD_shader_explicit_vertex_parameter)
+#endif /* GL_AMD_shader_explicit_vertex_parameter */
+/* ---------------------- GL_AMD_shader_stencil_export --------------------- */
+#ifndef GL_AMD_shader_stencil_export
+#define GL_AMD_shader_stencil_export 1
+#define GLEW_AMD_shader_stencil_export GLEW_GET_VAR(__GLEW_AMD_shader_stencil_export)
+#endif /* GL_AMD_shader_stencil_export */
+/* ------------------- GL_AMD_shader_stencil_value_export ------------------ */
+#ifndef GL_AMD_shader_stencil_value_export
+#define GL_AMD_shader_stencil_value_export 1
+#define GLEW_AMD_shader_stencil_value_export GLEW_GET_VAR(__GLEW_AMD_shader_stencil_value_export)
+#endif /* GL_AMD_shader_stencil_value_export */
+/* ---------------------- GL_AMD_shader_trinary_minmax --------------------- */
+#ifndef GL_AMD_shader_trinary_minmax
+#define GL_AMD_shader_trinary_minmax 1
+#define GLEW_AMD_shader_trinary_minmax GLEW_GET_VAR(__GLEW_AMD_shader_trinary_minmax)
+#endif /* GL_AMD_shader_trinary_minmax */
+/* ------------------------- GL_AMD_sparse_texture ------------------------- */
+#ifndef GL_AMD_sparse_texture
+#define GL_AMD_sparse_texture 1
+#define GL_VIRTUAL_PAGE_SIZE_X_AMD 0x9195
+#define GL_VIRTUAL_PAGE_SIZE_Y_AMD 0x9196
+#define GL_VIRTUAL_PAGE_SIZE_Z_AMD 0x9197
+#define GL_MIN_LOD_WARNING_AMD 0x919C
+typedef void (GLAPIENTRY * PFNGLTEXSTORAGESPARSEAMDPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLsizei layers, GLbitfield flags);
+typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGESPARSEAMDPROC) (GLuint texture, GLenum target, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLsizei layers, GLbitfield flags);
+#define glTexStorageSparseAMD GLEW_GET_FUN(__glewTexStorageSparseAMD)
+#define glTextureStorageSparseAMD GLEW_GET_FUN(__glewTextureStorageSparseAMD)
+#define GLEW_AMD_sparse_texture GLEW_GET_VAR(__GLEW_AMD_sparse_texture)
+#endif /* GL_AMD_sparse_texture */
+/* ------------------- GL_AMD_stencil_operation_extended ------------------- */
+#ifndef GL_AMD_stencil_operation_extended
+#define GL_AMD_stencil_operation_extended 1
+#define GL_SET_AMD 0x874A
+#define GL_REPLACE_VALUE_AMD 0x874B
+typedef void (GLAPIENTRY * PFNGLSTENCILOPVALUEAMDPROC) (GLenum face, GLuint value);
+#define glStencilOpValueAMD GLEW_GET_FUN(__glewStencilOpValueAMD)
+#define GLEW_AMD_stencil_operation_extended GLEW_GET_VAR(__GLEW_AMD_stencil_operation_extended)
+#endif /* GL_AMD_stencil_operation_extended */
+/* --------------------- GL_AMD_texture_gather_bias_lod -------------------- */
+#ifndef GL_AMD_texture_gather_bias_lod
+#define GL_AMD_texture_gather_bias_lod 1
+#define GLEW_AMD_texture_gather_bias_lod GLEW_GET_VAR(__GLEW_AMD_texture_gather_bias_lod)
+#endif /* GL_AMD_texture_gather_bias_lod */
+/* ------------------------ GL_AMD_texture_texture4 ------------------------ */
+#ifndef GL_AMD_texture_texture4
+#define GL_AMD_texture_texture4 1
+#define GLEW_AMD_texture_texture4 GLEW_GET_VAR(__GLEW_AMD_texture_texture4)
+#endif /* GL_AMD_texture_texture4 */
+/* --------------- GL_AMD_transform_feedback3_lines_triangles -------------- */
+#ifndef GL_AMD_transform_feedback3_lines_triangles
+#define GL_AMD_transform_feedback3_lines_triangles 1
+#define GLEW_AMD_transform_feedback3_lines_triangles GLEW_GET_VAR(__GLEW_AMD_transform_feedback3_lines_triangles)
+#endif /* GL_AMD_transform_feedback3_lines_triangles */
+/* ----------------------- GL_AMD_transform_feedback4 ---------------------- */
+#ifndef GL_AMD_transform_feedback4
+#define GL_AMD_transform_feedback4 1
+#define GLEW_AMD_transform_feedback4 GLEW_GET_VAR(__GLEW_AMD_transform_feedback4)
+#endif /* GL_AMD_transform_feedback4 */
+/* ----------------------- GL_AMD_vertex_shader_layer ---------------------- */
+#ifndef GL_AMD_vertex_shader_layer
+#define GL_AMD_vertex_shader_layer 1
+#define GLEW_AMD_vertex_shader_layer GLEW_GET_VAR(__GLEW_AMD_vertex_shader_layer)
+#endif /* GL_AMD_vertex_shader_layer */
+/* -------------------- GL_AMD_vertex_shader_tessellator ------------------- */
+#ifndef GL_AMD_vertex_shader_tessellator
+#define GL_AMD_vertex_shader_tessellator 1
+#define GL_SAMPLER_BUFFER_AMD 0x9001
+#define GL_DISCRETE_AMD 0x9006
+#define GL_CONTINUOUS_AMD 0x9007
+#define glTessellationFactorAMD GLEW_GET_FUN(__glewTessellationFactorAMD)
+#define glTessellationModeAMD GLEW_GET_FUN(__glewTessellationModeAMD)
+#define GLEW_AMD_vertex_shader_tessellator GLEW_GET_VAR(__GLEW_AMD_vertex_shader_tessellator)
+#endif /* GL_AMD_vertex_shader_tessellator */
+/* ------------------ GL_AMD_vertex_shader_viewport_index ------------------ */
+#ifndef GL_AMD_vertex_shader_viewport_index
+#define GL_AMD_vertex_shader_viewport_index 1
+#define GLEW_AMD_vertex_shader_viewport_index GLEW_GET_VAR(__GLEW_AMD_vertex_shader_viewport_index)
+#endif /* GL_AMD_vertex_shader_viewport_index */
+/* -------------------- GL_ANDROID_extension_pack_es31a -------------------- */
+#ifndef GL_ANDROID_extension_pack_es31a
+#define GL_ANDROID_extension_pack_es31a 1
+#define GLEW_ANDROID_extension_pack_es31a GLEW_GET_VAR(__GLEW_ANDROID_extension_pack_es31a)
+#endif /* GL_ANDROID_extension_pack_es31a */
+/* ------------------------- GL_ANGLE_depth_texture ------------------------ */
+#ifndef GL_ANGLE_depth_texture
+#define GL_ANGLE_depth_texture 1
+#define GLEW_ANGLE_depth_texture GLEW_GET_VAR(__GLEW_ANGLE_depth_texture)
+#endif /* GL_ANGLE_depth_texture */
+/* ----------------------- GL_ANGLE_framebuffer_blit ----------------------- */
+#ifndef GL_ANGLE_framebuffer_blit
+#define GL_ANGLE_framebuffer_blit 1
+typedef void (GLAPIENTRY * PFNGLBLITFRAMEBUFFERANGLEPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter);
+#define glBlitFramebufferANGLE GLEW_GET_FUN(__glewBlitFramebufferANGLE)
+#define GLEW_ANGLE_framebuffer_blit GLEW_GET_VAR(__GLEW_ANGLE_framebuffer_blit)
+#endif /* GL_ANGLE_framebuffer_blit */
+/* -------------------- GL_ANGLE_framebuffer_multisample ------------------- */
+#ifndef GL_ANGLE_framebuffer_multisample
+#define GL_ANGLE_framebuffer_multisample 1
+#define GL_MAX_SAMPLES_ANGLE 0x8D57
+typedef void (GLAPIENTRY * PFNGLRENDERBUFFERSTORAGEMULTISAMPLEANGLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height);
+#define glRenderbufferStorageMultisampleANGLE GLEW_GET_FUN(__glewRenderbufferStorageMultisampleANGLE)
+#define GLEW_ANGLE_framebuffer_multisample GLEW_GET_VAR(__GLEW_ANGLE_framebuffer_multisample)
+#endif /* GL_ANGLE_framebuffer_multisample */
+/* ----------------------- GL_ANGLE_instanced_arrays ----------------------- */
+#ifndef GL_ANGLE_instanced_arrays
+#define GL_ANGLE_instanced_arrays 1
+typedef void (GLAPIENTRY * PFNGLDRAWARRAYSINSTANCEDANGLEPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDANGLEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBDIVISORANGLEPROC) (GLuint index, GLuint divisor);
+#define glDrawArraysInstancedANGLE GLEW_GET_FUN(__glewDrawArraysInstancedANGLE)
+#define glDrawElementsInstancedANGLE GLEW_GET_FUN(__glewDrawElementsInstancedANGLE)
+#define glVertexAttribDivisorANGLE GLEW_GET_FUN(__glewVertexAttribDivisorANGLE)
+#define GLEW_ANGLE_instanced_arrays GLEW_GET_VAR(__GLEW_ANGLE_instanced_arrays)
+#endif /* GL_ANGLE_instanced_arrays */
+/* -------------------- GL_ANGLE_pack_reverse_row_order -------------------- */
+#ifndef GL_ANGLE_pack_reverse_row_order
+#define GL_ANGLE_pack_reverse_row_order 1
+#define GLEW_ANGLE_pack_reverse_row_order GLEW_GET_VAR(__GLEW_ANGLE_pack_reverse_row_order)
+#endif /* GL_ANGLE_pack_reverse_row_order */
+/* ------------------------ GL_ANGLE_program_binary ------------------------ */
+#ifndef GL_ANGLE_program_binary
+#define GL_ANGLE_program_binary 1
+#define GLEW_ANGLE_program_binary GLEW_GET_VAR(__GLEW_ANGLE_program_binary)
+#endif /* GL_ANGLE_program_binary */
+/* ------------------- GL_ANGLE_texture_compression_dxt1 ------------------- */
+#ifndef GL_ANGLE_texture_compression_dxt1
+#define GL_ANGLE_texture_compression_dxt1 1
+#define GLEW_ANGLE_texture_compression_dxt1 GLEW_GET_VAR(__GLEW_ANGLE_texture_compression_dxt1)
+#endif /* GL_ANGLE_texture_compression_dxt1 */
+/* ------------------- GL_ANGLE_texture_compression_dxt3 ------------------- */
+#ifndef GL_ANGLE_texture_compression_dxt3
+#define GL_ANGLE_texture_compression_dxt3 1
+#define GLEW_ANGLE_texture_compression_dxt3 GLEW_GET_VAR(__GLEW_ANGLE_texture_compression_dxt3)
+#endif /* GL_ANGLE_texture_compression_dxt3 */
+/* ------------------- GL_ANGLE_texture_compression_dxt5 ------------------- */
+#ifndef GL_ANGLE_texture_compression_dxt5
+#define GL_ANGLE_texture_compression_dxt5 1
+#define GLEW_ANGLE_texture_compression_dxt5 GLEW_GET_VAR(__GLEW_ANGLE_texture_compression_dxt5)
+#endif /* GL_ANGLE_texture_compression_dxt5 */
+/* ------------------------- GL_ANGLE_texture_usage ------------------------ */
+#ifndef GL_ANGLE_texture_usage
+#define GL_ANGLE_texture_usage 1
+#define GLEW_ANGLE_texture_usage GLEW_GET_VAR(__GLEW_ANGLE_texture_usage)
+#endif /* GL_ANGLE_texture_usage */
+/* -------------------------- GL_ANGLE_timer_query ------------------------- */
+#ifndef GL_ANGLE_timer_query
+#define GL_ANGLE_timer_query 1
+#define GL_CURRENT_QUERY_ANGLE 0x8865
+#define GL_QUERY_RESULT_ANGLE 0x8866
+#define GL_TIMESTAMP_ANGLE 0x8E28
+typedef void (GLAPIENTRY * PFNGLBEGINQUERYANGLEPROC) (GLenum target, GLuint id);
+typedef void (GLAPIENTRY * PFNGLDELETEQUERIESANGLEPROC) (GLsizei n, const GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLENDQUERYANGLEPROC) (GLenum target);
+typedef void (GLAPIENTRY * PFNGLGENQUERIESANGLEPROC) (GLsizei n, GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTI64VANGLEPROC) (GLuint id, GLenum pname, GLint64* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTIVANGLEPROC) (GLuint id, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTUI64VANGLEPROC) (GLuint id, GLenum pname, GLuint64* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTUIVANGLEPROC) (GLuint id, GLenum pname, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYIVANGLEPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLQUERYCOUNTERANGLEPROC) (GLuint id, GLenum target);
+#define glBeginQueryANGLE GLEW_GET_FUN(__glewBeginQueryANGLE)
+#define glDeleteQueriesANGLE GLEW_GET_FUN(__glewDeleteQueriesANGLE)
+#define glEndQueryANGLE GLEW_GET_FUN(__glewEndQueryANGLE)
+#define glGenQueriesANGLE GLEW_GET_FUN(__glewGenQueriesANGLE)
+#define glGetQueryObjecti64vANGLE GLEW_GET_FUN(__glewGetQueryObjecti64vANGLE)
+#define glGetQueryObjectivANGLE GLEW_GET_FUN(__glewGetQueryObjectivANGLE)
+#define glGetQueryObjectui64vANGLE GLEW_GET_FUN(__glewGetQueryObjectui64vANGLE)
+#define glGetQueryObjectuivANGLE GLEW_GET_FUN(__glewGetQueryObjectuivANGLE)
+#define glGetQueryivANGLE GLEW_GET_FUN(__glewGetQueryivANGLE)
+#define glIsQueryANGLE GLEW_GET_FUN(__glewIsQueryANGLE)
+#define glQueryCounterANGLE GLEW_GET_FUN(__glewQueryCounterANGLE)
+#define GLEW_ANGLE_timer_query GLEW_GET_VAR(__GLEW_ANGLE_timer_query)
+#endif /* GL_ANGLE_timer_query */
+/* ------------------- GL_ANGLE_translated_shader_source ------------------- */
+#ifndef GL_ANGLE_translated_shader_source
+#define GL_ANGLE_translated_shader_source 1
+typedef void (GLAPIENTRY * PFNGLGETTRANSLATEDSHADERSOURCEANGLEPROC) (GLuint shader, GLsizei bufsize, GLsizei* length, GLchar* source);
+#define glGetTranslatedShaderSourceANGLE GLEW_GET_FUN(__glewGetTranslatedShaderSourceANGLE)
+#define GLEW_ANGLE_translated_shader_source GLEW_GET_VAR(__GLEW_ANGLE_translated_shader_source)
+#endif /* GL_ANGLE_translated_shader_source */
+/* ----------------------- GL_APPLE_aux_depth_stencil ---------------------- */
+#ifndef GL_APPLE_aux_depth_stencil
+#define GL_APPLE_aux_depth_stencil 1
+#define GLEW_APPLE_aux_depth_stencil GLEW_GET_VAR(__GLEW_APPLE_aux_depth_stencil)
+#endif /* GL_APPLE_aux_depth_stencil */
+/* ------------------------ GL_APPLE_client_storage ------------------------ */
+#ifndef GL_APPLE_client_storage
+#define GL_APPLE_client_storage 1
+#define GLEW_APPLE_client_storage GLEW_GET_VAR(__GLEW_APPLE_client_storage)
+#endif /* GL_APPLE_client_storage */
+/* ------------------------- GL_APPLE_clip_distance ------------------------ */
+#ifndef GL_APPLE_clip_distance
+#define GL_APPLE_clip_distance 1
+#define GL_CLIP_DISTANCE0_APPLE 0x3000
+#define GL_CLIP_DISTANCE1_APPLE 0x3001
+#define GL_CLIP_DISTANCE2_APPLE 0x3002
+#define GL_CLIP_DISTANCE3_APPLE 0x3003
+#define GL_CLIP_DISTANCE4_APPLE 0x3004
+#define GL_CLIP_DISTANCE5_APPLE 0x3005
+#define GL_CLIP_DISTANCE6_APPLE 0x3006
+#define GL_CLIP_DISTANCE7_APPLE 0x3007
+#define GLEW_APPLE_clip_distance GLEW_GET_VAR(__GLEW_APPLE_clip_distance)
+#endif /* GL_APPLE_clip_distance */
+/* ------------------- GL_APPLE_color_buffer_packed_float ------------------ */
+#ifndef GL_APPLE_color_buffer_packed_float
+#define GL_APPLE_color_buffer_packed_float 1
+#define GLEW_APPLE_color_buffer_packed_float GLEW_GET_VAR(__GLEW_APPLE_color_buffer_packed_float)
+#endif /* GL_APPLE_color_buffer_packed_float */
+/* ---------------------- GL_APPLE_copy_texture_levels --------------------- */
+#ifndef GL_APPLE_copy_texture_levels
+#define GL_APPLE_copy_texture_levels 1
+typedef void (GLAPIENTRY * PFNGLCOPYTEXTURELEVELSAPPLEPROC) (GLuint destinationTexture, GLuint sourceTexture, GLint sourceBaseLevel, GLsizei sourceLevelCount);
+#define glCopyTextureLevelsAPPLE GLEW_GET_FUN(__glewCopyTextureLevelsAPPLE)
+#define GLEW_APPLE_copy_texture_levels GLEW_GET_VAR(__GLEW_APPLE_copy_texture_levels)
+#endif /* GL_APPLE_copy_texture_levels */
+/* ------------------------- GL_APPLE_element_array ------------------------ */
+#ifndef GL_APPLE_element_array
+#define GL_APPLE_element_array 1
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, GLint first, GLsizei count);
+typedef void (GLAPIENTRY * PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count);
+typedef void (GLAPIENTRY * PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const void *pointer);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, const GLint* first, const GLsizei *count, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, const GLint* first, const GLsizei *count, GLsizei primcount);
+#define glDrawElementArrayAPPLE GLEW_GET_FUN(__glewDrawElementArrayAPPLE)
+#define glDrawRangeElementArrayAPPLE GLEW_GET_FUN(__glewDrawRangeElementArrayAPPLE)
+#define glElementPointerAPPLE GLEW_GET_FUN(__glewElementPointerAPPLE)
+#define glMultiDrawElementArrayAPPLE GLEW_GET_FUN(__glewMultiDrawElementArrayAPPLE)
+#define glMultiDrawRangeElementArrayAPPLE GLEW_GET_FUN(__glewMultiDrawRangeElementArrayAPPLE)
+#define GLEW_APPLE_element_array GLEW_GET_VAR(__GLEW_APPLE_element_array)
+#endif /* GL_APPLE_element_array */
+/* ----------------------------- GL_APPLE_fence ---------------------------- */
+#ifndef GL_APPLE_fence
+#define GL_APPLE_fence 1
+#define GL_FENCE_APPLE 0x8A0B
+typedef void (GLAPIENTRY * PFNGLDELETEFENCESAPPLEPROC) (GLsizei n, const GLuint* fences);
+typedef void (GLAPIENTRY * PFNGLFINISHOBJECTAPPLEPROC) (GLenum object, GLint name);
+typedef void (GLAPIENTRY * PFNGLGENFENCESAPPLEPROC) (GLsizei n, GLuint* fences);
+typedef GLboolean (GLAPIENTRY * PFNGLISFENCEAPPLEPROC) (GLuint fence);
+typedef GLboolean (GLAPIENTRY * PFNGLTESTOBJECTAPPLEPROC) (GLenum object, GLuint name);
+#define glDeleteFencesAPPLE GLEW_GET_FUN(__glewDeleteFencesAPPLE)
+#define glFinishFenceAPPLE GLEW_GET_FUN(__glewFinishFenceAPPLE)
+#define glFinishObjectAPPLE GLEW_GET_FUN(__glewFinishObjectAPPLE)
+#define glGenFencesAPPLE GLEW_GET_FUN(__glewGenFencesAPPLE)
+#define glIsFenceAPPLE GLEW_GET_FUN(__glewIsFenceAPPLE)
+#define glSetFenceAPPLE GLEW_GET_FUN(__glewSetFenceAPPLE)
+#define glTestFenceAPPLE GLEW_GET_FUN(__glewTestFenceAPPLE)
+#define glTestObjectAPPLE GLEW_GET_FUN(__glewTestObjectAPPLE)
+#define GLEW_APPLE_fence GLEW_GET_VAR(__GLEW_APPLE_fence)
+#endif /* GL_APPLE_fence */
+/* ------------------------- GL_APPLE_float_pixels ------------------------- */
+#ifndef GL_APPLE_float_pixels
+#define GL_APPLE_float_pixels 1
+#define GL_HALF_APPLE 0x140B
+#define GL_RGBA_FLOAT32_APPLE 0x8814
+#define GL_RGB_FLOAT32_APPLE 0x8815
+#define GL_ALPHA_FLOAT32_APPLE 0x8816
+#define GL_INTENSITY_FLOAT32_APPLE 0x8817
+#define GL_LUMINANCE_FLOAT32_APPLE 0x8818
+#define GL_RGBA_FLOAT16_APPLE 0x881A
+#define GL_RGB_FLOAT16_APPLE 0x881B
+#define GL_ALPHA_FLOAT16_APPLE 0x881C
+#define GLEW_APPLE_float_pixels GLEW_GET_VAR(__GLEW_APPLE_float_pixels)
+#endif /* GL_APPLE_float_pixels */
+/* ---------------------- GL_APPLE_flush_buffer_range ---------------------- */
+#ifndef GL_APPLE_flush_buffer_range
+#define GL_APPLE_flush_buffer_range 1
+typedef void (GLAPIENTRY * PFNGLBUFFERPARAMETERIAPPLEPROC) (GLenum target, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLFLUSHMAPPEDBUFFERRANGEAPPLEPROC) (GLenum target, GLintptr offset, GLsizeiptr size);
+#define glBufferParameteriAPPLE GLEW_GET_FUN(__glewBufferParameteriAPPLE)
+#define glFlushMappedBufferRangeAPPLE GLEW_GET_FUN(__glewFlushMappedBufferRangeAPPLE)
+#define GLEW_APPLE_flush_buffer_range GLEW_GET_VAR(__GLEW_APPLE_flush_buffer_range)
+#endif /* GL_APPLE_flush_buffer_range */
+/* -------------------- GL_APPLE_framebuffer_multisample ------------------- */
+#ifndef GL_APPLE_framebuffer_multisample
+#define GL_APPLE_framebuffer_multisample 1
+#define GL_MAX_SAMPLES_APPLE 0x8D57
+typedef void (GLAPIENTRY * PFNGLRENDERBUFFERSTORAGEMULTISAMPLEAPPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height);
+#define glRenderbufferStorageMultisampleAPPLE GLEW_GET_FUN(__glewRenderbufferStorageMultisampleAPPLE)
+#define glResolveMultisampleFramebufferAPPLE GLEW_GET_FUN(__glewResolveMultisampleFramebufferAPPLE)
+#define GLEW_APPLE_framebuffer_multisample GLEW_GET_VAR(__GLEW_APPLE_framebuffer_multisample)
+#endif /* GL_APPLE_framebuffer_multisample */
+/* ----------------------- GL_APPLE_object_purgeable ----------------------- */
+#ifndef GL_APPLE_object_purgeable
+#define GL_APPLE_object_purgeable 1
+#define GL_RELEASED_APPLE 0x8A19
+typedef void (GLAPIENTRY * PFNGLGETOBJECTPARAMETERIVAPPLEPROC) (GLenum objectType, GLuint name, GLenum pname, GLint* params);
+typedef GLenum (GLAPIENTRY * PFNGLOBJECTPURGEABLEAPPLEPROC) (GLenum objectType, GLuint name, GLenum option);
+typedef GLenum (GLAPIENTRY * PFNGLOBJECTUNPURGEABLEAPPLEPROC) (GLenum objectType, GLuint name, GLenum option);
+#define glGetObjectParameterivAPPLE GLEW_GET_FUN(__glewGetObjectParameterivAPPLE)
+#define glObjectPurgeableAPPLE GLEW_GET_FUN(__glewObjectPurgeableAPPLE)
+#define glObjectUnpurgeableAPPLE GLEW_GET_FUN(__glewObjectUnpurgeableAPPLE)
+#define GLEW_APPLE_object_purgeable GLEW_GET_VAR(__GLEW_APPLE_object_purgeable)
+#endif /* GL_APPLE_object_purgeable */
+/* ------------------------- GL_APPLE_pixel_buffer ------------------------- */
+#ifndef GL_APPLE_pixel_buffer
+#define GL_APPLE_pixel_buffer 1
+#define GLEW_APPLE_pixel_buffer GLEW_GET_VAR(__GLEW_APPLE_pixel_buffer)
+#endif /* GL_APPLE_pixel_buffer */
+/* ---------------------------- GL_APPLE_rgb_422 --------------------------- */
+#ifndef GL_APPLE_rgb_422
+#define GL_APPLE_rgb_422 1
+#define GL_RGB_422_APPLE 0x8A1F
+#define GL_RGB_RAW_422_APPLE 0x8A51
+#define GLEW_APPLE_rgb_422 GLEW_GET_VAR(__GLEW_APPLE_rgb_422)
+#endif /* GL_APPLE_rgb_422 */
+/* --------------------------- GL_APPLE_row_bytes -------------------------- */
+#ifndef GL_APPLE_row_bytes
+#define GL_APPLE_row_bytes 1
+#define GLEW_APPLE_row_bytes GLEW_GET_VAR(__GLEW_APPLE_row_bytes)
+#endif /* GL_APPLE_row_bytes */
+/* ------------------------ GL_APPLE_specular_vector ----------------------- */
+#ifndef GL_APPLE_specular_vector
+#define GL_APPLE_specular_vector 1
+#define GLEW_APPLE_specular_vector GLEW_GET_VAR(__GLEW_APPLE_specular_vector)
+#endif /* GL_APPLE_specular_vector */
+/* ----------------------------- GL_APPLE_sync ----------------------------- */
+#ifndef GL_APPLE_sync
+#define GL_APPLE_sync 1
+#define GL_SYNC_OBJECT_APPLE 0x8A53
+#define GL_OBJECT_TYPE_APPLE 0x9112
+#define GL_SYNC_STATUS_APPLE 0x9114
+#define GL_SYNC_FLAGS_APPLE 0x9115
+#define GL_SYNC_FENCE_APPLE 0x9116
+#define GL_UNSIGNALED_APPLE 0x9118
+#define GL_SIGNALED_APPLE 0x9119
+#define GL_WAIT_FAILED_APPLE 0x911D
+typedef GLenum (GLAPIENTRY * PFNGLCLIENTWAITSYNCAPPLEPROC) (GLsync GLsync, GLbitfield flags, GLuint64 timeout);
+typedef GLsync (GLAPIENTRY * PFNGLFENCESYNCAPPLEPROC) (GLenum condition, GLbitfield flags);
+typedef void (GLAPIENTRY * PFNGLGETINTEGER64VAPPLEPROC) (GLenum pname, GLint64* params);
+typedef void (GLAPIENTRY * PFNGLGETSYNCIVAPPLEPROC) (GLsync GLsync, GLenum pname, GLsizei bufSize, GLsizei* length, GLint *values);
+typedef void (GLAPIENTRY * PFNGLWAITSYNCAPPLEPROC) (GLsync GLsync, GLbitfield flags, GLuint64 timeout);
+#define glClientWaitSyncAPPLE GLEW_GET_FUN(__glewClientWaitSyncAPPLE)
+#define glDeleteSyncAPPLE GLEW_GET_FUN(__glewDeleteSyncAPPLE)
+#define glFenceSyncAPPLE GLEW_GET_FUN(__glewFenceSyncAPPLE)
+#define glGetInteger64vAPPLE GLEW_GET_FUN(__glewGetInteger64vAPPLE)
+#define glGetSyncivAPPLE GLEW_GET_FUN(__glewGetSyncivAPPLE)
+#define glIsSyncAPPLE GLEW_GET_FUN(__glewIsSyncAPPLE)
+#define glWaitSyncAPPLE GLEW_GET_FUN(__glewWaitSyncAPPLE)
+#define GLEW_APPLE_sync GLEW_GET_VAR(__GLEW_APPLE_sync)
+#endif /* GL_APPLE_sync */
+/* -------------------- GL_APPLE_texture_2D_limited_npot ------------------- */
+#ifndef GL_APPLE_texture_2D_limited_npot
+#define GL_APPLE_texture_2D_limited_npot 1
+#define GLEW_APPLE_texture_2D_limited_npot GLEW_GET_VAR(__GLEW_APPLE_texture_2D_limited_npot)
+#endif /* GL_APPLE_texture_2D_limited_npot */
+/* -------------------- GL_APPLE_texture_format_BGRA8888 ------------------- */
+#ifndef GL_APPLE_texture_format_BGRA8888
+#define GL_APPLE_texture_format_BGRA8888 1
+#define GL_BGRA_EXT 0x80E1
+#define GL_BGRA8_EXT 0x93A1
+#define GLEW_APPLE_texture_format_BGRA8888 GLEW_GET_VAR(__GLEW_APPLE_texture_format_BGRA8888)
+#endif /* GL_APPLE_texture_format_BGRA8888 */
+/* ----------------------- GL_APPLE_texture_max_level ---------------------- */
+#ifndef GL_APPLE_texture_max_level
+#define GL_APPLE_texture_max_level 1
+#define GLEW_APPLE_texture_max_level GLEW_GET_VAR(__GLEW_APPLE_texture_max_level)
+#endif /* GL_APPLE_texture_max_level */
+/* --------------------- GL_APPLE_texture_packed_float --------------------- */
+#ifndef GL_APPLE_texture_packed_float
+#define GL_APPLE_texture_packed_float 1
+#define GL_R11F_G11F_B10F_APPLE 0x8C3A
+#define GL_UNSIGNED_INT_10F_11F_11F_REV_APPLE 0x8C3B
+#define GL_RGB9_E5_APPLE 0x8C3D
+#define GL_UNSIGNED_INT_5_9_9_9_REV_APPLE 0x8C3E
+#define GLEW_APPLE_texture_packed_float GLEW_GET_VAR(__GLEW_APPLE_texture_packed_float)
+#endif /* GL_APPLE_texture_packed_float */
+/* ------------------------- GL_APPLE_texture_range ------------------------ */
+#ifndef GL_APPLE_texture_range
+#define GL_APPLE_texture_range 1
+typedef void (GLAPIENTRY * PFNGLGETTEXPARAMETERPOINTERVAPPLEPROC) (GLenum target, GLenum pname, void **params);
+typedef void (GLAPIENTRY * PFNGLTEXTURERANGEAPPLEPROC) (GLenum target, GLsizei length, void *pointer);
+#define glGetTexParameterPointervAPPLE GLEW_GET_FUN(__glewGetTexParameterPointervAPPLE)
+#define glTextureRangeAPPLE GLEW_GET_FUN(__glewTextureRangeAPPLE)
+#define GLEW_APPLE_texture_range GLEW_GET_VAR(__GLEW_APPLE_texture_range)
+#endif /* GL_APPLE_texture_range */
+/* ------------------------ GL_APPLE_transform_hint ------------------------ */
+#ifndef GL_APPLE_transform_hint
+#define GL_APPLE_transform_hint 1
+#define GLEW_APPLE_transform_hint GLEW_GET_VAR(__GLEW_APPLE_transform_hint)
+#endif /* GL_APPLE_transform_hint */
+/* ---------------------- GL_APPLE_vertex_array_object --------------------- */
+#ifndef GL_APPLE_vertex_array_object
+#define GL_APPLE_vertex_array_object 1
+typedef void (GLAPIENTRY * PFNGLDELETEVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint* arrays);
+typedef void (GLAPIENTRY * PFNGLGENVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint* arrays);
+#define glBindVertexArrayAPPLE GLEW_GET_FUN(__glewBindVertexArrayAPPLE)
+#define glDeleteVertexArraysAPPLE GLEW_GET_FUN(__glewDeleteVertexArraysAPPLE)
+#define glGenVertexArraysAPPLE GLEW_GET_FUN(__glewGenVertexArraysAPPLE)
+#define glIsVertexArrayAPPLE GLEW_GET_FUN(__glewIsVertexArrayAPPLE)
+#define GLEW_APPLE_vertex_array_object GLEW_GET_VAR(__GLEW_APPLE_vertex_array_object)
+#endif /* GL_APPLE_vertex_array_object */
+/* ---------------------- GL_APPLE_vertex_array_range ---------------------- */
+#ifndef GL_APPLE_vertex_array_range
+#define GL_APPLE_vertex_array_range 1
+typedef void (GLAPIENTRY * PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, void *pointer);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, void *pointer);
+#define glFlushVertexArrayRangeAPPLE GLEW_GET_FUN(__glewFlushVertexArrayRangeAPPLE)
+#define glVertexArrayParameteriAPPLE GLEW_GET_FUN(__glewVertexArrayParameteriAPPLE)
+#define glVertexArrayRangeAPPLE GLEW_GET_FUN(__glewVertexArrayRangeAPPLE)
+#define GLEW_APPLE_vertex_array_range GLEW_GET_VAR(__GLEW_APPLE_vertex_array_range)
+#endif /* GL_APPLE_vertex_array_range */
+/* ------------------- GL_APPLE_vertex_program_evaluators ------------------ */
+#ifndef GL_APPLE_vertex_program_evaluators
+#define GL_APPLE_vertex_program_evaluators 1
+typedef void (GLAPIENTRY * PFNGLMAPVERTEXATTRIB1DAPPLEPROC) (GLuint index, GLuint size, GLdouble u1, GLdouble u2, GLint stride, GLint order, const GLdouble* points);
+typedef void (GLAPIENTRY * PFNGLMAPVERTEXATTRIB1FAPPLEPROC) (GLuint index, GLuint size, GLfloat u1, GLfloat u2, GLint stride, GLint order, const GLfloat* points);
+typedef void (GLAPIENTRY * PFNGLMAPVERTEXATTRIB2DAPPLEPROC) (GLuint index, GLuint size, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, const GLdouble* points);
+typedef void (GLAPIENTRY * PFNGLMAPVERTEXATTRIB2FAPPLEPROC) (GLuint index, GLuint size, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, const GLfloat* points);
+#define glDisableVertexAttribAPPLE GLEW_GET_FUN(__glewDisableVertexAttribAPPLE)
+#define glEnableVertexAttribAPPLE GLEW_GET_FUN(__glewEnableVertexAttribAPPLE)
+#define glIsVertexAttribEnabledAPPLE GLEW_GET_FUN(__glewIsVertexAttribEnabledAPPLE)
+#define glMapVertexAttrib1dAPPLE GLEW_GET_FUN(__glewMapVertexAttrib1dAPPLE)
+#define glMapVertexAttrib1fAPPLE GLEW_GET_FUN(__glewMapVertexAttrib1fAPPLE)
+#define glMapVertexAttrib2dAPPLE GLEW_GET_FUN(__glewMapVertexAttrib2dAPPLE)
+#define glMapVertexAttrib2fAPPLE GLEW_GET_FUN(__glewMapVertexAttrib2fAPPLE)
+#define GLEW_APPLE_vertex_program_evaluators GLEW_GET_VAR(__GLEW_APPLE_vertex_program_evaluators)
+#endif /* GL_APPLE_vertex_program_evaluators */
+/* --------------------------- GL_APPLE_ycbcr_422 -------------------------- */
+#ifndef GL_APPLE_ycbcr_422
+#define GL_APPLE_ycbcr_422 1
+#define GL_YCBCR_422_APPLE 0x85B9
+#define GLEW_APPLE_ycbcr_422 GLEW_GET_VAR(__GLEW_APPLE_ycbcr_422)
+#endif /* GL_APPLE_ycbcr_422 */
+/* ------------------------ GL_ARB_ES2_compatibility ----------------------- */
+#ifndef GL_ARB_ES2_compatibility
+#define GL_ARB_ES2_compatibility 1
+#define GL_FIXED 0x140C
+#define GL_RGB565 0x8D62
+#define GL_LOW_FLOAT 0x8DF0
+#define GL_MEDIUM_FLOAT 0x8DF1
+#define GL_HIGH_FLOAT 0x8DF2
+#define GL_LOW_INT 0x8DF3
+#define GL_MEDIUM_INT 0x8DF4
+#define GL_HIGH_INT 0x8DF5
+typedef int GLfixed;
+typedef void (GLAPIENTRY * PFNGLDEPTHRANGEFPROC) (GLclampf n, GLclampf f);
+typedef void (GLAPIENTRY * PFNGLGETSHADERPRECISIONFORMATPROC) (GLenum shadertype, GLenum precisiontype, GLint* range, GLint *precision);
+typedef void (GLAPIENTRY * PFNGLSHADERBINARYPROC) (GLsizei count, const GLuint* shaders, GLenum binaryformat, const void*binary, GLsizei length);
+#define glClearDepthf GLEW_GET_FUN(__glewClearDepthf)
+#define glDepthRangef GLEW_GET_FUN(__glewDepthRangef)
+#define glGetShaderPrecisionFormat GLEW_GET_FUN(__glewGetShaderPrecisionFormat)
+#define glReleaseShaderCompiler GLEW_GET_FUN(__glewReleaseShaderCompiler)
+#define glShaderBinary GLEW_GET_FUN(__glewShaderBinary)
+#define GLEW_ARB_ES2_compatibility GLEW_GET_VAR(__GLEW_ARB_ES2_compatibility)
+#endif /* GL_ARB_ES2_compatibility */
+/* ----------------------- GL_ARB_ES3_1_compatibility ---------------------- */
+#ifndef GL_ARB_ES3_1_compatibility
+#define GL_ARB_ES3_1_compatibility 1
+#define glMemoryBarrierByRegion GLEW_GET_FUN(__glewMemoryBarrierByRegion)
+#define GLEW_ARB_ES3_1_compatibility GLEW_GET_VAR(__GLEW_ARB_ES3_1_compatibility)
+#endif /* GL_ARB_ES3_1_compatibility */
+/* ----------------------- GL_ARB_ES3_2_compatibility ---------------------- */
+#ifndef GL_ARB_ES3_2_compatibility
+#define GL_ARB_ES3_2_compatibility 1
+typedef void (GLAPIENTRY * PFNGLPRIMITIVEBOUNDINGBOXARBPROC) (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW);
+#define glPrimitiveBoundingBoxARB GLEW_GET_FUN(__glewPrimitiveBoundingBoxARB)
+#define GLEW_ARB_ES3_2_compatibility GLEW_GET_VAR(__GLEW_ARB_ES3_2_compatibility)
+#endif /* GL_ARB_ES3_2_compatibility */
+/* ------------------------ GL_ARB_ES3_compatibility ----------------------- */
+#ifndef GL_ARB_ES3_compatibility
+#define GL_ARB_ES3_compatibility 1
+#define GL_COMPRESSED_R11_EAC 0x9270
+#define GL_COMPRESSED_SIGNED_R11_EAC 0x9271
+#define GL_COMPRESSED_RG11_EAC 0x9272
+#define GL_COMPRESSED_RGB8_ETC2 0x9274
+#define GL_COMPRESSED_SRGB8_ETC2 0x9275
+#define GL_COMPRESSED_RGBA8_ETC2_EAC 0x9278
+#define GLEW_ARB_ES3_compatibility GLEW_GET_VAR(__GLEW_ARB_ES3_compatibility)
+#endif /* GL_ARB_ES3_compatibility */
+/* ------------------------ GL_ARB_arrays_of_arrays ------------------------ */
+#ifndef GL_ARB_arrays_of_arrays
+#define GL_ARB_arrays_of_arrays 1
+#define GLEW_ARB_arrays_of_arrays GLEW_GET_VAR(__GLEW_ARB_arrays_of_arrays)
+#endif /* GL_ARB_arrays_of_arrays */
+/* -------------------------- GL_ARB_base_instance ------------------------- */
+#ifndef GL_ARB_base_instance
+#define GL_ARB_base_instance 1
+typedef void (GLAPIENTRY * PFNGLDRAWARRAYSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount, GLuint baseinstance);
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount, GLuint baseinstance);
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount, GLint basevertex, GLuint baseinstance);
+#define glDrawArraysInstancedBaseInstance GLEW_GET_FUN(__glewDrawArraysInstancedBaseInstance)
+#define glDrawElementsInstancedBaseInstance GLEW_GET_FUN(__glewDrawElementsInstancedBaseInstance)
+#define glDrawElementsInstancedBaseVertexBaseInstance GLEW_GET_FUN(__glewDrawElementsInstancedBaseVertexBaseInstance)
+#define GLEW_ARB_base_instance GLEW_GET_VAR(__GLEW_ARB_base_instance)
+#endif /* GL_ARB_base_instance */
+/* ------------------------ GL_ARB_bindless_texture ------------------------ */
+#ifndef GL_ARB_bindless_texture
+#define GL_ARB_bindless_texture 1
+#define GL_UNSIGNED_INT64_ARB 0x140F
+typedef GLuint64 (GLAPIENTRY * PFNGLGETIMAGEHANDLEARBPROC) (GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum format);
+typedef GLuint64 (GLAPIENTRY * PFNGLGETTEXTURESAMPLERHANDLEARBPROC) (GLuint texture, GLuint sampler);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBLUI64VARBPROC) (GLuint index, GLenum pname, GLuint64EXT* params);
+typedef void (GLAPIENTRY * PFNGLMAKEIMAGEHANDLERESIDENTARBPROC) (GLuint64 handle, GLenum access);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMHANDLEUI64ARBPROC) (GLuint program, GLint location, GLuint64 value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMHANDLEUI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64* values);
+typedef void (GLAPIENTRY * PFNGLUNIFORMHANDLEUI64ARBPROC) (GLint location, GLuint64 value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMHANDLEUI64VARBPROC) (GLint location, GLsizei count, const GLuint64* value);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBL1UI64ARBPROC) (GLuint index, GLuint64EXT x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBL1UI64VARBPROC) (GLuint index, const GLuint64EXT* v);
+#define glGetImageHandleARB GLEW_GET_FUN(__glewGetImageHandleARB)
+#define glGetTextureHandleARB GLEW_GET_FUN(__glewGetTextureHandleARB)
+#define glGetTextureSamplerHandleARB GLEW_GET_FUN(__glewGetTextureSamplerHandleARB)
+#define glGetVertexAttribLui64vARB GLEW_GET_FUN(__glewGetVertexAttribLui64vARB)
+#define glIsImageHandleResidentARB GLEW_GET_FUN(__glewIsImageHandleResidentARB)
+#define glIsTextureHandleResidentARB GLEW_GET_FUN(__glewIsTextureHandleResidentARB)
+#define glMakeImageHandleNonResidentARB GLEW_GET_FUN(__glewMakeImageHandleNonResidentARB)
+#define glMakeImageHandleResidentARB GLEW_GET_FUN(__glewMakeImageHandleResidentARB)
+#define glMakeTextureHandleNonResidentARB GLEW_GET_FUN(__glewMakeTextureHandleNonResidentARB)
+#define glMakeTextureHandleResidentARB GLEW_GET_FUN(__glewMakeTextureHandleResidentARB)
+#define glProgramUniformHandleui64ARB GLEW_GET_FUN(__glewProgramUniformHandleui64ARB)
+#define glProgramUniformHandleui64vARB GLEW_GET_FUN(__glewProgramUniformHandleui64vARB)
+#define glUniformHandleui64ARB GLEW_GET_FUN(__glewUniformHandleui64ARB)
+#define glUniformHandleui64vARB GLEW_GET_FUN(__glewUniformHandleui64vARB)
+#define glVertexAttribL1ui64ARB GLEW_GET_FUN(__glewVertexAttribL1ui64ARB)
+#define glVertexAttribL1ui64vARB GLEW_GET_FUN(__glewVertexAttribL1ui64vARB)
+#define GLEW_ARB_bindless_texture GLEW_GET_VAR(__GLEW_ARB_bindless_texture)
+#endif /* GL_ARB_bindless_texture */
+/* ----------------------- GL_ARB_blend_func_extended ---------------------- */
+#ifndef GL_ARB_blend_func_extended
+#define GL_ARB_blend_func_extended 1
+#define GL_SRC1_COLOR 0x88F9
+typedef void (GLAPIENTRY * PFNGLBINDFRAGDATALOCATIONINDEXEDPROC) (GLuint program, GLuint colorNumber, GLuint index, const GLchar * name);
+typedef GLint (GLAPIENTRY * PFNGLGETFRAGDATAINDEXPROC) (GLuint program, const GLchar * name);
+#define glBindFragDataLocationIndexed GLEW_GET_FUN(__glewBindFragDataLocationIndexed)
+#define glGetFragDataIndex GLEW_GET_FUN(__glewGetFragDataIndex)
+#define GLEW_ARB_blend_func_extended GLEW_GET_VAR(__GLEW_ARB_blend_func_extended)
+#endif /* GL_ARB_blend_func_extended */
+/* ------------------------- GL_ARB_buffer_storage ------------------------- */
+#ifndef GL_ARB_buffer_storage
+#define GL_ARB_buffer_storage 1
+#define GL_MAP_READ_BIT 0x0001
+#define GL_MAP_WRITE_BIT 0x0002
+#define GL_MAP_PERSISTENT_BIT 0x00000040
+#define GL_MAP_COHERENT_BIT 0x00000080
+#define GL_DYNAMIC_STORAGE_BIT 0x0100
+#define GL_CLIENT_STORAGE_BIT 0x0200
+typedef void (GLAPIENTRY * PFNGLBUFFERSTORAGEPROC) (GLenum target, GLsizeiptr size, const void *data, GLbitfield flags);
+#define glBufferStorage GLEW_GET_FUN(__glewBufferStorage)
+#define GLEW_ARB_buffer_storage GLEW_GET_VAR(__GLEW_ARB_buffer_storage)
+#endif /* GL_ARB_buffer_storage */
+/* ---------------------------- GL_ARB_cl_event ---------------------------- */
+#ifndef GL_ARB_cl_event
+#define GL_ARB_cl_event 1
+#define GL_SYNC_CL_EVENT_ARB 0x8240
+typedef struct _cl_context *cl_context;
+typedef struct _cl_event *cl_event;
+typedef GLsync (GLAPIENTRY * PFNGLCREATESYNCFROMCLEVENTARBPROC) (cl_context context, cl_event event, GLbitfield flags);
+#define glCreateSyncFromCLeventARB GLEW_GET_FUN(__glewCreateSyncFromCLeventARB)
+#define GLEW_ARB_cl_event GLEW_GET_VAR(__GLEW_ARB_cl_event)
+#endif /* GL_ARB_cl_event */
+/* ----------------------- GL_ARB_clear_buffer_object ---------------------- */
+#ifndef GL_ARB_clear_buffer_object
+#define GL_ARB_clear_buffer_object 1
+typedef void (GLAPIENTRY * PFNGLCLEARBUFFERDATAPROC) (GLenum target, GLenum internalformat, GLenum format, GLenum type, const void *data);
+typedef void (GLAPIENTRY * PFNGLCLEARBUFFERSUBDATAPROC) (GLenum target, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data);
+typedef void (GLAPIENTRY * PFNGLCLEARNAMEDBUFFERDATAEXTPROC) (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data);
+typedef void (GLAPIENTRY * PFNGLCLEARNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data);
+#define glClearBufferData GLEW_GET_FUN(__glewClearBufferData)
+#define glClearBufferSubData GLEW_GET_FUN(__glewClearBufferSubData)
+#define glClearNamedBufferDataEXT GLEW_GET_FUN(__glewClearNamedBufferDataEXT)
+#define glClearNamedBufferSubDataEXT GLEW_GET_FUN(__glewClearNamedBufferSubDataEXT)
+#define GLEW_ARB_clear_buffer_object GLEW_GET_VAR(__GLEW_ARB_clear_buffer_object)
+#endif /* GL_ARB_clear_buffer_object */
+/* -------------------------- GL_ARB_clear_texture ------------------------- */
+#ifndef GL_ARB_clear_texture
+#define GL_ARB_clear_texture 1
+#define GL_CLEAR_TEXTURE 0x9365
+typedef void (GLAPIENTRY * PFNGLCLEARTEXIMAGEPROC) (GLuint texture, GLint level, GLenum format, GLenum type, const void *data);
+typedef void (GLAPIENTRY * PFNGLCLEARTEXSUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *data);
+#define glClearTexImage GLEW_GET_FUN(__glewClearTexImage)
+#define glClearTexSubImage GLEW_GET_FUN(__glewClearTexSubImage)
+#define GLEW_ARB_clear_texture GLEW_GET_VAR(__GLEW_ARB_clear_texture)
+#endif /* GL_ARB_clear_texture */
+/* -------------------------- GL_ARB_clip_control -------------------------- */
+#ifndef GL_ARB_clip_control
+#define GL_ARB_clip_control 1
+#define GL_LOWER_LEFT 0x8CA1
+#define GL_UPPER_LEFT 0x8CA2
+#define GL_CLIP_ORIGIN 0x935C
+#define GL_CLIP_DEPTH_MODE 0x935D
+#define GL_NEGATIVE_ONE_TO_ONE 0x935E
+#define GL_ZERO_TO_ONE 0x935F
+typedef void (GLAPIENTRY * PFNGLCLIPCONTROLPROC) (GLenum origin, GLenum depth);
+#define glClipControl GLEW_GET_FUN(__glewClipControl)
+#define GLEW_ARB_clip_control GLEW_GET_VAR(__GLEW_ARB_clip_control)
+#endif /* GL_ARB_clip_control */
+/* ----------------------- GL_ARB_color_buffer_float ----------------------- */
+#ifndef GL_ARB_color_buffer_float
+#define GL_ARB_color_buffer_float 1
+#define GL_RGBA_FLOAT_MODE_ARB 0x8820
+#define GL_FIXED_ONLY_ARB 0x891D
+typedef void (GLAPIENTRY * PFNGLCLAMPCOLORARBPROC) (GLenum target, GLenum clamp);
+#define glClampColorARB GLEW_GET_FUN(__glewClampColorARB)
+#define GLEW_ARB_color_buffer_float GLEW_GET_VAR(__GLEW_ARB_color_buffer_float)
+#endif /* GL_ARB_color_buffer_float */
+/* -------------------------- GL_ARB_compatibility ------------------------- */
+#ifndef GL_ARB_compatibility
+#define GL_ARB_compatibility 1
+#define GLEW_ARB_compatibility GLEW_GET_VAR(__GLEW_ARB_compatibility)
+#endif /* GL_ARB_compatibility */
+/* ---------------- GL_ARB_compressed_texture_pixel_storage ---------------- */
+#ifndef GL_ARB_compressed_texture_pixel_storage
+#define GL_ARB_compressed_texture_pixel_storage 1
+#define GLEW_ARB_compressed_texture_pixel_storage GLEW_GET_VAR(__GLEW_ARB_compressed_texture_pixel_storage)
+#endif /* GL_ARB_compressed_texture_pixel_storage */
+/* ------------------------- GL_ARB_compute_shader ------------------------- */
+#ifndef GL_ARB_compute_shader
+#define GL_ARB_compute_shader 1
+#define GL_COMPUTE_SHADER_BIT 0x00000020
+#define GL_COMPUTE_SHADER 0x91B9
+typedef void (GLAPIENTRY * PFNGLDISPATCHCOMPUTEPROC) (GLuint num_groups_x, GLuint num_groups_y, GLuint num_groups_z);
+#define glDispatchCompute GLEW_GET_FUN(__glewDispatchCompute)
+#define glDispatchComputeIndirect GLEW_GET_FUN(__glewDispatchComputeIndirect)
+#define GLEW_ARB_compute_shader GLEW_GET_VAR(__GLEW_ARB_compute_shader)
+#endif /* GL_ARB_compute_shader */
+/* ------------------- GL_ARB_compute_variable_group_size ------------------ */
+#ifndef GL_ARB_compute_variable_group_size
+#define GL_ARB_compute_variable_group_size 1
+typedef void (GLAPIENTRY * PFNGLDISPATCHCOMPUTEGROUPSIZEARBPROC) (GLuint num_groups_x, GLuint num_groups_y, GLuint num_groups_z, GLuint group_size_x, GLuint group_size_y, GLuint group_size_z);
+#define glDispatchComputeGroupSizeARB GLEW_GET_FUN(__glewDispatchComputeGroupSizeARB)
+#define GLEW_ARB_compute_variable_group_size GLEW_GET_VAR(__GLEW_ARB_compute_variable_group_size)
+#endif /* GL_ARB_compute_variable_group_size */
+/* ------------------- GL_ARB_conditional_render_inverted ------------------ */
+#ifndef GL_ARB_conditional_render_inverted
+#define GL_ARB_conditional_render_inverted 1
+#define GLEW_ARB_conditional_render_inverted GLEW_GET_VAR(__GLEW_ARB_conditional_render_inverted)
+#endif /* GL_ARB_conditional_render_inverted */
+/* ----------------------- GL_ARB_conservative_depth ----------------------- */
+#ifndef GL_ARB_conservative_depth
+#define GL_ARB_conservative_depth 1
+#define GLEW_ARB_conservative_depth GLEW_GET_VAR(__GLEW_ARB_conservative_depth)
+#endif /* GL_ARB_conservative_depth */
+/* --------------------------- GL_ARB_copy_buffer -------------------------- */
+#ifndef GL_ARB_copy_buffer
+#define GL_ARB_copy_buffer 1
+#define GL_COPY_READ_BUFFER 0x8F36
+#define GL_COPY_WRITE_BUFFER 0x8F37
+typedef void (GLAPIENTRY * PFNGLCOPYBUFFERSUBDATAPROC) (GLenum readtarget, GLenum writetarget, GLintptr readoffset, GLintptr writeoffset, GLsizeiptr size);
+#define glCopyBufferSubData GLEW_GET_FUN(__glewCopyBufferSubData)
+#define GLEW_ARB_copy_buffer GLEW_GET_VAR(__GLEW_ARB_copy_buffer)
+#endif /* GL_ARB_copy_buffer */
+/* --------------------------- GL_ARB_copy_image --------------------------- */
+#ifndef GL_ARB_copy_image
+#define GL_ARB_copy_image 1
+typedef void (GLAPIENTRY * PFNGLCOPYIMAGESUBDATAPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth);
+#define glCopyImageSubData GLEW_GET_FUN(__glewCopyImageSubData)
+#define GLEW_ARB_copy_image GLEW_GET_VAR(__GLEW_ARB_copy_image)
+#endif /* GL_ARB_copy_image */
+/* -------------------------- GL_ARB_cull_distance ------------------------- */
+#ifndef GL_ARB_cull_distance
+#define GL_ARB_cull_distance 1
+#define GLEW_ARB_cull_distance GLEW_GET_VAR(__GLEW_ARB_cull_distance)
+#endif /* GL_ARB_cull_distance */
+/* -------------------------- GL_ARB_debug_output -------------------------- */
+#ifndef GL_ARB_debug_output
+#define GL_ARB_debug_output 1
+#define GL_DEBUG_SOURCE_API_ARB 0x8246
+#define GL_DEBUG_TYPE_OTHER_ARB 0x8251
+typedef void (GLAPIENTRY *GLDEBUGPROCARB)(GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar* message, const void* userParam);
+typedef void (GLAPIENTRY * PFNGLDEBUGMESSAGECONTROLARBPROC) (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint* ids, GLboolean enabled);
+typedef void (GLAPIENTRY * PFNGLDEBUGMESSAGEINSERTARBPROC) (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar* buf);
+typedef GLuint (GLAPIENTRY * PFNGLGETDEBUGMESSAGELOGARBPROC) (GLuint count, GLsizei bufSize, GLenum* sources, GLenum* types, GLuint* ids, GLenum* severities, GLsizei* lengths, GLchar* messageLog);
+#define glDebugMessageCallbackARB GLEW_GET_FUN(__glewDebugMessageCallbackARB)
+#define glDebugMessageControlARB GLEW_GET_FUN(__glewDebugMessageControlARB)
+#define glDebugMessageInsertARB GLEW_GET_FUN(__glewDebugMessageInsertARB)
+#define glGetDebugMessageLogARB GLEW_GET_FUN(__glewGetDebugMessageLogARB)
+#define GLEW_ARB_debug_output GLEW_GET_VAR(__GLEW_ARB_debug_output)
+#endif /* GL_ARB_debug_output */
+/* ----------------------- GL_ARB_depth_buffer_float ----------------------- */
+#ifndef GL_ARB_depth_buffer_float
+#define GL_ARB_depth_buffer_float 1
+#define GL_DEPTH32F_STENCIL8 0x8CAD
+#define GL_FLOAT_32_UNSIGNED_INT_24_8_REV 0x8DAD
+#define GLEW_ARB_depth_buffer_float GLEW_GET_VAR(__GLEW_ARB_depth_buffer_float)
+#endif /* GL_ARB_depth_buffer_float */
+/* --------------------------- GL_ARB_depth_clamp -------------------------- */
+#ifndef GL_ARB_depth_clamp
+#define GL_ARB_depth_clamp 1
+#define GL_DEPTH_CLAMP 0x864F
+#define GLEW_ARB_depth_clamp GLEW_GET_VAR(__GLEW_ARB_depth_clamp)
+#endif /* GL_ARB_depth_clamp */
+/* -------------------------- GL_ARB_depth_texture ------------------------- */
+#ifndef GL_ARB_depth_texture
+#define GL_ARB_depth_texture 1
+#define GL_DEPTH_COMPONENT16_ARB 0x81A5
+#define GL_DEPTH_COMPONENT24_ARB 0x81A6
+#define GL_DEPTH_COMPONENT32_ARB 0x81A7
+#define GLEW_ARB_depth_texture GLEW_GET_VAR(__GLEW_ARB_depth_texture)
+#endif /* GL_ARB_depth_texture */
+/* ----------------------- GL_ARB_derivative_control ----------------------- */
+#ifndef GL_ARB_derivative_control
+#define GL_ARB_derivative_control 1
+#define GLEW_ARB_derivative_control GLEW_GET_VAR(__GLEW_ARB_derivative_control)
+#endif /* GL_ARB_derivative_control */
+/* ----------------------- GL_ARB_direct_state_access ---------------------- */
+#ifndef GL_ARB_direct_state_access
+#define GL_ARB_direct_state_access 1
+#define GL_TEXTURE_TARGET 0x1006
+#define GL_QUERY_TARGET 0x82EA
+typedef void (GLAPIENTRY * PFNGLBINDTEXTUREUNITPROC) (GLuint unit, GLuint texture);
+typedef void (GLAPIENTRY * PFNGLBLITNAMEDFRAMEBUFFERPROC) (GLuint readFramebuffer, GLuint drawFramebuffer, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter);
+typedef GLenum (GLAPIENTRY * PFNGLCHECKNAMEDFRAMEBUFFERSTATUSPROC) (GLuint framebuffer, GLenum target);
+typedef void (GLAPIENTRY * PFNGLCLEARNAMEDBUFFERDATAPROC) (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data);
+typedef void (GLAPIENTRY * PFNGLCLEARNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data);
+typedef void (GLAPIENTRY * PFNGLCLEARNAMEDFRAMEBUFFERFIPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, GLfloat depth, GLint stencil);
+typedef void (GLAPIENTRY * PFNGLCLEARNAMEDFRAMEBUFFERFVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLCLEARNAMEDFRAMEBUFFERIVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLCLEARNAMEDFRAMEBUFFERUIVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOPYNAMEDBUFFERSUBDATAPROC) (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLCREATEBUFFERSPROC) (GLsizei n, GLuint* buffers);
+typedef void (GLAPIENTRY * PFNGLCREATEFRAMEBUFFERSPROC) (GLsizei n, GLuint* framebuffers);
+typedef void (GLAPIENTRY * PFNGLCREATEPROGRAMPIPELINESPROC) (GLsizei n, GLuint* pipelines);
+typedef void (GLAPIENTRY * PFNGLCREATEQUERIESPROC) (GLenum target, GLsizei n, GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLCREATERENDERBUFFERSPROC) (GLsizei n, GLuint* renderbuffers);
+typedef void (GLAPIENTRY * PFNGLCREATESAMPLERSPROC) (GLsizei n, GLuint* samplers);
+typedef void (GLAPIENTRY * PFNGLCREATETEXTURESPROC) (GLenum target, GLsizei n, GLuint* textures);
+typedef void (GLAPIENTRY * PFNGLCREATEVERTEXARRAYSPROC) (GLsizei n, GLuint* arrays);
+typedef void (GLAPIENTRY * PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length);
+typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXTUREIMAGEPROC) (GLuint texture, GLint level, GLsizei bufSize, void *pixels);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDBUFFERPARAMETERI64VPROC) (GLuint buffer, GLenum pname, GLint64* params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDBUFFERPARAMETERIVPROC) (GLuint buffer, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDBUFFERPOINTERVPROC) (GLuint buffer, GLenum pname, void** params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDFRAMEBUFFERATTACHMENTPARAMETERIVPROC) (GLuint framebuffer, GLenum attachment, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDFRAMEBUFFERPARAMETERIVPROC) (GLuint framebuffer, GLenum pname, GLint* param);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDRENDERBUFFERPARAMETERIVPROC) (GLuint renderbuffer, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYBUFFEROBJECTI64VPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLGETQUERYBUFFEROBJECTIVPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLGETQUERYBUFFEROBJECTUI64VPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLGETQUERYBUFFEROBJECTUIVPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLGETTEXTUREIMAGEPROC) (GLuint texture, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels);
+typedef void (GLAPIENTRY * PFNGLGETTEXTURELEVELPARAMETERFVPROC) (GLuint texture, GLint level, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXTURELEVELPARAMETERIVPROC) (GLuint texture, GLint level, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXTUREPARAMETERIIVPROC) (GLuint texture, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXTUREPARAMETERIUIVPROC) (GLuint texture, GLenum pname, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXTUREPARAMETERFVPROC) (GLuint texture, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXTUREPARAMETERIVPROC) (GLuint texture, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETTRANSFORMFEEDBACKI64_VPROC) (GLuint xfb, GLenum pname, GLuint index, GLint64* param);
+typedef void (GLAPIENTRY * PFNGLGETTRANSFORMFEEDBACKI_VPROC) (GLuint xfb, GLenum pname, GLuint index, GLint* param);
+typedef void (GLAPIENTRY * PFNGLGETTRANSFORMFEEDBACKIVPROC) (GLuint xfb, GLenum pname, GLint* param);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXARRAYINDEXED64IVPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint64* param);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXARRAYINDEXEDIVPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint* param);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXARRAYIVPROC) (GLuint vaobj, GLenum pname, GLint* param);
+typedef void (GLAPIENTRY * PFNGLINVALIDATENAMEDFRAMEBUFFERDATAPROC) (GLuint framebuffer, GLsizei numAttachments, const GLenum* attachments);
+typedef void (GLAPIENTRY * PFNGLINVALIDATENAMEDFRAMEBUFFERSUBDATAPROC) (GLuint framebuffer, GLsizei numAttachments, const GLenum* attachments, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void * (GLAPIENTRY * PFNGLMAPNAMEDBUFFERPROC) (GLuint buffer, GLenum access);
+typedef void * (GLAPIENTRY * PFNGLMAPNAMEDBUFFERRANGEPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access);
+typedef void (GLAPIENTRY * PFNGLNAMEDBUFFERDATAPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage);
+typedef void (GLAPIENTRY * PFNGLNAMEDBUFFERSTORAGEPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags);
+typedef void (GLAPIENTRY * PFNGLNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERDRAWBUFFERPROC) (GLuint framebuffer, GLenum mode);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERDRAWBUFFERSPROC) (GLuint framebuffer, GLsizei n, const GLenum* bufs);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERPARAMETERIPROC) (GLuint framebuffer, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERREADBUFFERPROC) (GLuint framebuffer, GLenum mode);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERRENDERBUFFERPROC) (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERTEXTUREPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERTEXTURELAYERPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer);
+typedef void (GLAPIENTRY * PFNGLNAMEDRENDERBUFFERSTORAGEPROC) (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEPROC) (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLTEXTUREBUFFERPROC) (GLuint texture, GLenum internalformat, GLuint buffer);
+typedef void (GLAPIENTRY * PFNGLTEXTUREBUFFERRANGEPROC) (GLuint texture, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERIIVPROC) (GLuint texture, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERIUIVPROC) (GLuint texture, GLenum pname, const GLuint* params);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERFPROC) (GLuint texture, GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERFVPROC) (GLuint texture, GLenum pname, const GLfloat* param);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERIPROC) (GLuint texture, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERIVPROC) (GLuint texture, GLenum pname, const GLint* param);
+typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE1DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE2DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE2DMULTISAMPLEPROC) (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations);
+typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE3DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth);
+typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE3DMULTISAMPLEPROC) (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations);
+typedef void (GLAPIENTRY * PFNGLTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLTRANSFORMFEEDBACKBUFFERBASEPROC) (GLuint xfb, GLuint index, GLuint buffer);
+typedef void (GLAPIENTRY * PFNGLTRANSFORMFEEDBACKBUFFERRANGEPROC) (GLuint xfb, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYATTRIBBINDINGPROC) (GLuint vaobj, GLuint attribindex, GLuint bindingindex);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYATTRIBFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYATTRIBIFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYATTRIBLFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYBINDINGDIVISORPROC) (GLuint vaobj, GLuint bindingindex, GLuint divisor);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXBUFFERPROC) (GLuint vaobj, GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXBUFFERSPROC) (GLuint vaobj, GLuint first, GLsizei count, const GLuint* buffers, const GLintptr *offsets, const GLsizei *strides);
+#define glBindTextureUnit GLEW_GET_FUN(__glewBindTextureUnit)
+#define glBlitNamedFramebuffer GLEW_GET_FUN(__glewBlitNamedFramebuffer)
+#define glCheckNamedFramebufferStatus GLEW_GET_FUN(__glewCheckNamedFramebufferStatus)
+#define glClearNamedBufferData GLEW_GET_FUN(__glewClearNamedBufferData)
+#define glClearNamedBufferSubData GLEW_GET_FUN(__glewClearNamedBufferSubData)
+#define glClearNamedFramebufferfi GLEW_GET_FUN(__glewClearNamedFramebufferfi)
+#define glClearNamedFramebufferfv GLEW_GET_FUN(__glewClearNamedFramebufferfv)
+#define glClearNamedFramebufferiv GLEW_GET_FUN(__glewClearNamedFramebufferiv)
+#define glClearNamedFramebufferuiv GLEW_GET_FUN(__glewClearNamedFramebufferuiv)
+#define glCompressedTextureSubImage1D GLEW_GET_FUN(__glewCompressedTextureSubImage1D)
+#define glCompressedTextureSubImage2D GLEW_GET_FUN(__glewCompressedTextureSubImage2D)
+#define glCompressedTextureSubImage3D GLEW_GET_FUN(__glewCompressedTextureSubImage3D)
+#define glCopyNamedBufferSubData GLEW_GET_FUN(__glewCopyNamedBufferSubData)
+#define glCopyTextureSubImage1D GLEW_GET_FUN(__glewCopyTextureSubImage1D)
+#define glCopyTextureSubImage2D GLEW_GET_FUN(__glewCopyTextureSubImage2D)
+#define glCopyTextureSubImage3D GLEW_GET_FUN(__glewCopyTextureSubImage3D)
+#define glCreateBuffers GLEW_GET_FUN(__glewCreateBuffers)
+#define glCreateFramebuffers GLEW_GET_FUN(__glewCreateFramebuffers)
+#define glCreateProgramPipelines GLEW_GET_FUN(__glewCreateProgramPipelines)
+#define glCreateQueries GLEW_GET_FUN(__glewCreateQueries)
+#define glCreateRenderbuffers GLEW_GET_FUN(__glewCreateRenderbuffers)
+#define glCreateSamplers GLEW_GET_FUN(__glewCreateSamplers)
+#define glCreateTextures GLEW_GET_FUN(__glewCreateTextures)
+#define glCreateTransformFeedbacks GLEW_GET_FUN(__glewCreateTransformFeedbacks)
+#define glCreateVertexArrays GLEW_GET_FUN(__glewCreateVertexArrays)
+#define glDisableVertexArrayAttrib GLEW_GET_FUN(__glewDisableVertexArrayAttrib)
+#define glEnableVertexArrayAttrib GLEW_GET_FUN(__glewEnableVertexArrayAttrib)
+#define glFlushMappedNamedBufferRange GLEW_GET_FUN(__glewFlushMappedNamedBufferRange)
+#define glGenerateTextureMipmap GLEW_GET_FUN(__glewGenerateTextureMipmap)
+#define glGetCompressedTextureImage GLEW_GET_FUN(__glewGetCompressedTextureImage)
+#define glGetNamedBufferParameteri64v GLEW_GET_FUN(__glewGetNamedBufferParameteri64v)
+#define glGetNamedBufferParameteriv GLEW_GET_FUN(__glewGetNamedBufferParameteriv)
+#define glGetNamedBufferPointerv GLEW_GET_FUN(__glewGetNamedBufferPointerv)
+#define glGetNamedBufferSubData GLEW_GET_FUN(__glewGetNamedBufferSubData)
+#define glGetNamedFramebufferAttachmentParameteriv GLEW_GET_FUN(__glewGetNamedFramebufferAttachmentParameteriv)
+#define glGetNamedFramebufferParameteriv GLEW_GET_FUN(__glewGetNamedFramebufferParameteriv)
+#define glGetNamedRenderbufferParameteriv GLEW_GET_FUN(__glewGetNamedRenderbufferParameteriv)
+#define glGetQueryBufferObjecti64v GLEW_GET_FUN(__glewGetQueryBufferObjecti64v)
+#define glGetQueryBufferObjectiv GLEW_GET_FUN(__glewGetQueryBufferObjectiv)
+#define glGetQueryBufferObjectui64v GLEW_GET_FUN(__glewGetQueryBufferObjectui64v)
+#define glGetQueryBufferObjectuiv GLEW_GET_FUN(__glewGetQueryBufferObjectuiv)
+#define glGetTextureImage GLEW_GET_FUN(__glewGetTextureImage)
+#define glGetTextureLevelParameterfv GLEW_GET_FUN(__glewGetTextureLevelParameterfv)
+#define glGetTextureLevelParameteriv GLEW_GET_FUN(__glewGetTextureLevelParameteriv)
+#define glGetTextureParameterIiv GLEW_GET_FUN(__glewGetTextureParameterIiv)
+#define glGetTextureParameterIuiv GLEW_GET_FUN(__glewGetTextureParameterIuiv)
+#define glGetTextureParameterfv GLEW_GET_FUN(__glewGetTextureParameterfv)
+#define glGetTextureParameteriv GLEW_GET_FUN(__glewGetTextureParameteriv)
+#define glGetTransformFeedbacki64_v GLEW_GET_FUN(__glewGetTransformFeedbacki64_v)
+#define glGetTransformFeedbacki_v GLEW_GET_FUN(__glewGetTransformFeedbacki_v)
+#define glGetTransformFeedbackiv GLEW_GET_FUN(__glewGetTransformFeedbackiv)
+#define glGetVertexArrayIndexed64iv GLEW_GET_FUN(__glewGetVertexArrayIndexed64iv)
+#define glGetVertexArrayIndexediv GLEW_GET_FUN(__glewGetVertexArrayIndexediv)
+#define glGetVertexArrayiv GLEW_GET_FUN(__glewGetVertexArrayiv)
+#define glInvalidateNamedFramebufferData GLEW_GET_FUN(__glewInvalidateNamedFramebufferData)
+#define glInvalidateNamedFramebufferSubData GLEW_GET_FUN(__glewInvalidateNamedFramebufferSubData)
+#define glMapNamedBuffer GLEW_GET_FUN(__glewMapNamedBuffer)
+#define glMapNamedBufferRange GLEW_GET_FUN(__glewMapNamedBufferRange)
+#define glNamedBufferData GLEW_GET_FUN(__glewNamedBufferData)
+#define glNamedBufferStorage GLEW_GET_FUN(__glewNamedBufferStorage)
+#define glNamedBufferSubData GLEW_GET_FUN(__glewNamedBufferSubData)
+#define glNamedFramebufferDrawBuffer GLEW_GET_FUN(__glewNamedFramebufferDrawBuffer)
+#define glNamedFramebufferDrawBuffers GLEW_GET_FUN(__glewNamedFramebufferDrawBuffers)
+#define glNamedFramebufferParameteri GLEW_GET_FUN(__glewNamedFramebufferParameteri)
+#define glNamedFramebufferReadBuffer GLEW_GET_FUN(__glewNamedFramebufferReadBuffer)
+#define glNamedFramebufferRenderbuffer GLEW_GET_FUN(__glewNamedFramebufferRenderbuffer)
+#define glNamedFramebufferTexture GLEW_GET_FUN(__glewNamedFramebufferTexture)
+#define glNamedFramebufferTextureLayer GLEW_GET_FUN(__glewNamedFramebufferTextureLayer)
+#define glNamedRenderbufferStorage GLEW_GET_FUN(__glewNamedRenderbufferStorage)
+#define glNamedRenderbufferStorageMultisample GLEW_GET_FUN(__glewNamedRenderbufferStorageMultisample)
+#define glTextureBuffer GLEW_GET_FUN(__glewTextureBuffer)
+#define glTextureBufferRange GLEW_GET_FUN(__glewTextureBufferRange)
+#define glTextureParameterIiv GLEW_GET_FUN(__glewTextureParameterIiv)
+#define glTextureParameterIuiv GLEW_GET_FUN(__glewTextureParameterIuiv)
+#define glTextureParameterf GLEW_GET_FUN(__glewTextureParameterf)
+#define glTextureParameterfv GLEW_GET_FUN(__glewTextureParameterfv)
+#define glTextureParameteri GLEW_GET_FUN(__glewTextureParameteri)
+#define glTextureParameteriv GLEW_GET_FUN(__glewTextureParameteriv)
+#define glTextureStorage1D GLEW_GET_FUN(__glewTextureStorage1D)
+#define glTextureStorage2D GLEW_GET_FUN(__glewTextureStorage2D)
+#define glTextureStorage2DMultisample GLEW_GET_FUN(__glewTextureStorage2DMultisample)
+#define glTextureStorage3D GLEW_GET_FUN(__glewTextureStorage3D)
+#define glTextureStorage3DMultisample GLEW_GET_FUN(__glewTextureStorage3DMultisample)
+#define glTextureSubImage1D GLEW_GET_FUN(__glewTextureSubImage1D)
+#define glTextureSubImage2D GLEW_GET_FUN(__glewTextureSubImage2D)
+#define glTextureSubImage3D GLEW_GET_FUN(__glewTextureSubImage3D)
+#define glTransformFeedbackBufferBase GLEW_GET_FUN(__glewTransformFeedbackBufferBase)
+#define glTransformFeedbackBufferRange GLEW_GET_FUN(__glewTransformFeedbackBufferRange)
+#define glUnmapNamedBuffer GLEW_GET_FUN(__glewUnmapNamedBuffer)
+#define glVertexArrayAttribBinding GLEW_GET_FUN(__glewVertexArrayAttribBinding)
+#define glVertexArrayAttribFormat GLEW_GET_FUN(__glewVertexArrayAttribFormat)
+#define glVertexArrayAttribIFormat GLEW_GET_FUN(__glewVertexArrayAttribIFormat)
+#define glVertexArrayAttribLFormat GLEW_GET_FUN(__glewVertexArrayAttribLFormat)
+#define glVertexArrayBindingDivisor GLEW_GET_FUN(__glewVertexArrayBindingDivisor)
+#define glVertexArrayElementBuffer GLEW_GET_FUN(__glewVertexArrayElementBuffer)
+#define glVertexArrayVertexBuffer GLEW_GET_FUN(__glewVertexArrayVertexBuffer)
+#define glVertexArrayVertexBuffers GLEW_GET_FUN(__glewVertexArrayVertexBuffers)
+#define GLEW_ARB_direct_state_access GLEW_GET_VAR(__GLEW_ARB_direct_state_access)
+#endif /* GL_ARB_direct_state_access */
+/* -------------------------- GL_ARB_draw_buffers -------------------------- */
+#ifndef GL_ARB_draw_buffers
+#define GL_ARB_draw_buffers 1
+#define GL_MAX_DRAW_BUFFERS_ARB 0x8824
+#define GL_DRAW_BUFFER0_ARB 0x8825
+#define GL_DRAW_BUFFER1_ARB 0x8826
+#define GL_DRAW_BUFFER2_ARB 0x8827
+#define GL_DRAW_BUFFER3_ARB 0x8828
+#define GL_DRAW_BUFFER4_ARB 0x8829
+#define GL_DRAW_BUFFER5_ARB 0x882A
+#define GL_DRAW_BUFFER6_ARB 0x882B
+#define GL_DRAW_BUFFER7_ARB 0x882C
+#define GL_DRAW_BUFFER8_ARB 0x882D
+#define GL_DRAW_BUFFER9_ARB 0x882E
+#define GL_DRAW_BUFFER10_ARB 0x882F
+#define GL_DRAW_BUFFER11_ARB 0x8830
+#define GL_DRAW_BUFFER12_ARB 0x8831
+#define GL_DRAW_BUFFER13_ARB 0x8832
+#define GL_DRAW_BUFFER14_ARB 0x8833
+#define GL_DRAW_BUFFER15_ARB 0x8834
+typedef void (GLAPIENTRY * PFNGLDRAWBUFFERSARBPROC) (GLsizei n, const GLenum* bufs);
+#define glDrawBuffersARB GLEW_GET_FUN(__glewDrawBuffersARB)
+#define GLEW_ARB_draw_buffers GLEW_GET_VAR(__GLEW_ARB_draw_buffers)
+#endif /* GL_ARB_draw_buffers */
+/* ----------------------- GL_ARB_draw_buffers_blend ----------------------- */
+#ifndef GL_ARB_draw_buffers_blend
+#define GL_ARB_draw_buffers_blend 1
+typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONSEPARATEIARBPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha);
+typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONIARBPROC) (GLuint buf, GLenum mode);
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCSEPARATEIARBPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha);
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCIARBPROC) (GLuint buf, GLenum src, GLenum dst);
+#define glBlendEquationSeparateiARB GLEW_GET_FUN(__glewBlendEquationSeparateiARB)
+#define glBlendEquationiARB GLEW_GET_FUN(__glewBlendEquationiARB)
+#define glBlendFuncSeparateiARB GLEW_GET_FUN(__glewBlendFuncSeparateiARB)
+#define glBlendFunciARB GLEW_GET_FUN(__glewBlendFunciARB)
+#define GLEW_ARB_draw_buffers_blend GLEW_GET_VAR(__GLEW_ARB_draw_buffers_blend)
+#endif /* GL_ARB_draw_buffers_blend */
+/* -------------------- GL_ARB_draw_elements_base_vertex ------------------- */
+#ifndef GL_ARB_draw_elements_base_vertex
+#define GL_ARB_draw_elements_base_vertex 1
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, void *indices, GLint basevertex);
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount, GLint basevertex);
+typedef void (GLAPIENTRY * PFNGLDRAWRANGEELEMENTSBASEVERTEXPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, void *indices, GLint basevertex);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, GLsizei* count, GLenum type, void**indices, GLsizei primcount, GLint *basevertex);
+#define glDrawElementsBaseVertex GLEW_GET_FUN(__glewDrawElementsBaseVertex)
+#define glDrawElementsInstancedBaseVertex GLEW_GET_FUN(__glewDrawElementsInstancedBaseVertex)
+#define glDrawRangeElementsBaseVertex GLEW_GET_FUN(__glewDrawRangeElementsBaseVertex)
+#define glMultiDrawElementsBaseVertex GLEW_GET_FUN(__glewMultiDrawElementsBaseVertex)
+#define GLEW_ARB_draw_elements_base_vertex GLEW_GET_VAR(__GLEW_ARB_draw_elements_base_vertex)
+#endif /* GL_ARB_draw_elements_base_vertex */
+/* -------------------------- GL_ARB_draw_indirect ------------------------- */
+#ifndef GL_ARB_draw_indirect
+#define GL_ARB_draw_indirect 1
+typedef void (GLAPIENTRY * PFNGLDRAWARRAYSINDIRECTPROC) (GLenum mode, const void *indirect);
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum type, const void *indirect);
+#define glDrawArraysIndirect GLEW_GET_FUN(__glewDrawArraysIndirect)
+#define glDrawElementsIndirect GLEW_GET_FUN(__glewDrawElementsIndirect)
+#define GLEW_ARB_draw_indirect GLEW_GET_VAR(__GLEW_ARB_draw_indirect)
+#endif /* GL_ARB_draw_indirect */
+/* ------------------------- GL_ARB_draw_instanced ------------------------- */
+#ifndef GL_ARB_draw_instanced
+#define GL_ARB_draw_instanced 1
+#define GLEW_ARB_draw_instanced GLEW_GET_VAR(__GLEW_ARB_draw_instanced)
+#endif /* GL_ARB_draw_instanced */
+/* ------------------------ GL_ARB_enhanced_layouts ------------------------ */
+#ifndef GL_ARB_enhanced_layouts
+#define GL_ARB_enhanced_layouts 1
+#define GLEW_ARB_enhanced_layouts GLEW_GET_VAR(__GLEW_ARB_enhanced_layouts)
+#endif /* GL_ARB_enhanced_layouts */
+/* -------------------- GL_ARB_explicit_attrib_location -------------------- */
+#ifndef GL_ARB_explicit_attrib_location
+#define GL_ARB_explicit_attrib_location 1
+#define GLEW_ARB_explicit_attrib_location GLEW_GET_VAR(__GLEW_ARB_explicit_attrib_location)
+#endif /* GL_ARB_explicit_attrib_location */
+/* -------------------- GL_ARB_explicit_uniform_location ------------------- */
+#ifndef GL_ARB_explicit_uniform_location
+#define GL_ARB_explicit_uniform_location 1
+#define GLEW_ARB_explicit_uniform_location GLEW_GET_VAR(__GLEW_ARB_explicit_uniform_location)
+#endif /* GL_ARB_explicit_uniform_location */
+/* ------------------- GL_ARB_fragment_coord_conventions ------------------- */
+#ifndef GL_ARB_fragment_coord_conventions
+#define GL_ARB_fragment_coord_conventions 1
+#define GLEW_ARB_fragment_coord_conventions GLEW_GET_VAR(__GLEW_ARB_fragment_coord_conventions)
+#endif /* GL_ARB_fragment_coord_conventions */
+/* --------------------- GL_ARB_fragment_layer_viewport -------------------- */
+#ifndef GL_ARB_fragment_layer_viewport
+#define GL_ARB_fragment_layer_viewport 1
+#define GLEW_ARB_fragment_layer_viewport GLEW_GET_VAR(__GLEW_ARB_fragment_layer_viewport)
+#endif /* GL_ARB_fragment_layer_viewport */
+/* ------------------------ GL_ARB_fragment_program ------------------------ */
+#ifndef GL_ARB_fragment_program
+#define GL_ARB_fragment_program 1
+#define GLEW_ARB_fragment_program GLEW_GET_VAR(__GLEW_ARB_fragment_program)
+#endif /* GL_ARB_fragment_program */
+/* --------------------- GL_ARB_fragment_program_shadow -------------------- */
+#ifndef GL_ARB_fragment_program_shadow
+#define GL_ARB_fragment_program_shadow 1
+#define GLEW_ARB_fragment_program_shadow GLEW_GET_VAR(__GLEW_ARB_fragment_program_shadow)
+#endif /* GL_ARB_fragment_program_shadow */
+/* ------------------------- GL_ARB_fragment_shader ------------------------ */
+#ifndef GL_ARB_fragment_shader
+#define GL_ARB_fragment_shader 1
+#define GLEW_ARB_fragment_shader GLEW_GET_VAR(__GLEW_ARB_fragment_shader)
+#endif /* GL_ARB_fragment_shader */
+/* -------------------- GL_ARB_fragment_shader_interlock ------------------- */
+#ifndef GL_ARB_fragment_shader_interlock
+#define GL_ARB_fragment_shader_interlock 1
+#define GLEW_ARB_fragment_shader_interlock GLEW_GET_VAR(__GLEW_ARB_fragment_shader_interlock)
+#endif /* GL_ARB_fragment_shader_interlock */
+/* ------------------- GL_ARB_framebuffer_no_attachments ------------------- */
+#ifndef GL_ARB_framebuffer_no_attachments
+#define GL_ARB_framebuffer_no_attachments 1
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERPARAMETERIPROC) (GLenum target, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLGETFRAMEBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDFRAMEBUFFERPARAMETERIVEXTPROC) (GLuint framebuffer, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERPARAMETERIEXTPROC) (GLuint framebuffer, GLenum pname, GLint param);
+#define glFramebufferParameteri GLEW_GET_FUN(__glewFramebufferParameteri)
+#define glGetFramebufferParameteriv GLEW_GET_FUN(__glewGetFramebufferParameteriv)
+#define glGetNamedFramebufferParameterivEXT GLEW_GET_FUN(__glewGetNamedFramebufferParameterivEXT)
+#define glNamedFramebufferParameteriEXT GLEW_GET_FUN(__glewNamedFramebufferParameteriEXT)
+#define GLEW_ARB_framebuffer_no_attachments GLEW_GET_VAR(__GLEW_ARB_framebuffer_no_attachments)
+#endif /* GL_ARB_framebuffer_no_attachments */
+/* ----------------------- GL_ARB_framebuffer_object ----------------------- */
+#ifndef GL_ARB_framebuffer_object
+#define GL_ARB_framebuffer_object 1
+#define GL_INDEX 0x8222
+#define GL_DEPTH_STENCIL 0x84F9
+#define GL_UNSIGNED_INT_24_8 0x84FA
+#define GL_DEPTH24_STENCIL8 0x88F0
+#define GL_SRGB 0x8C40
+#define GL_FRAMEBUFFER 0x8D40
+#define GL_RENDERBUFFER 0x8D41
+#define GL_STENCIL_INDEX1 0x8D46
+#define GL_STENCIL_INDEX4 0x8D47
+#define GL_STENCIL_INDEX8 0x8D48
+#define GL_STENCIL_INDEX16 0x8D49
+#define GL_MAX_SAMPLES 0x8D57
+typedef void (GLAPIENTRY * PFNGLBINDFRAMEBUFFERPROC) (GLenum target, GLuint framebuffer);
+typedef void (GLAPIENTRY * PFNGLBINDRENDERBUFFERPROC) (GLenum target, GLuint renderbuffer);
+typedef void (GLAPIENTRY * PFNGLBLITFRAMEBUFFERPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter);
+typedef void (GLAPIENTRY * PFNGLDELETEFRAMEBUFFERSPROC) (GLsizei n, const GLuint* framebuffers);
+typedef void (GLAPIENTRY * PFNGLDELETERENDERBUFFERSPROC) (GLsizei n, const GLuint* renderbuffers);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERRENDERBUFFERPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURE1DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURE2DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURE3DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint layer);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURELAYERPROC) (GLenum target,GLenum attachment, GLuint texture,GLint level,GLint layer);
+typedef void (GLAPIENTRY * PFNGLGENFRAMEBUFFERSPROC) (GLsizei n, GLuint* framebuffers);
+typedef void (GLAPIENTRY * PFNGLGENRENDERBUFFERSPROC) (GLsizei n, GLuint* renderbuffers);
+typedef void (GLAPIENTRY * PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVPROC) (GLenum target, GLenum attachment, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETRENDERBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISFRAMEBUFFERPROC) (GLuint framebuffer);
+typedef GLboolean (GLAPIENTRY * PFNGLISRENDERBUFFERPROC) (GLuint renderbuffer);
+typedef void (GLAPIENTRY * PFNGLRENDERBUFFERSTORAGEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLRENDERBUFFERSTORAGEMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height);
+#define glBindFramebuffer GLEW_GET_FUN(__glewBindFramebuffer)
+#define glBindRenderbuffer GLEW_GET_FUN(__glewBindRenderbuffer)
+#define glBlitFramebuffer GLEW_GET_FUN(__glewBlitFramebuffer)
+#define glCheckFramebufferStatus GLEW_GET_FUN(__glewCheckFramebufferStatus)
+#define glDeleteFramebuffers GLEW_GET_FUN(__glewDeleteFramebuffers)
+#define glDeleteRenderbuffers GLEW_GET_FUN(__glewDeleteRenderbuffers)
+#define glFramebufferRenderbuffer GLEW_GET_FUN(__glewFramebufferRenderbuffer)
+#define glFramebufferTexture1D GLEW_GET_FUN(__glewFramebufferTexture1D)
+#define glFramebufferTexture2D GLEW_GET_FUN(__glewFramebufferTexture2D)
+#define glFramebufferTexture3D GLEW_GET_FUN(__glewFramebufferTexture3D)
+#define glFramebufferTextureLayer GLEW_GET_FUN(__glewFramebufferTextureLayer)
+#define glGenFramebuffers GLEW_GET_FUN(__glewGenFramebuffers)
+#define glGenRenderbuffers GLEW_GET_FUN(__glewGenRenderbuffers)
+#define glGenerateMipmap GLEW_GET_FUN(__glewGenerateMipmap)
+#define glGetFramebufferAttachmentParameteriv GLEW_GET_FUN(__glewGetFramebufferAttachmentParameteriv)
+#define glGetRenderbufferParameteriv GLEW_GET_FUN(__glewGetRenderbufferParameteriv)
+#define glIsFramebuffer GLEW_GET_FUN(__glewIsFramebuffer)
+#define glIsRenderbuffer GLEW_GET_FUN(__glewIsRenderbuffer)
+#define glRenderbufferStorage GLEW_GET_FUN(__glewRenderbufferStorage)
+#define glRenderbufferStorageMultisample GLEW_GET_FUN(__glewRenderbufferStorageMultisample)
+#define GLEW_ARB_framebuffer_object GLEW_GET_VAR(__GLEW_ARB_framebuffer_object)
+#endif /* GL_ARB_framebuffer_object */
+/* ------------------------ GL_ARB_framebuffer_sRGB ------------------------ */
+#ifndef GL_ARB_framebuffer_sRGB
+#define GL_ARB_framebuffer_sRGB 1
+#define GLEW_ARB_framebuffer_sRGB GLEW_GET_VAR(__GLEW_ARB_framebuffer_sRGB)
+#endif /* GL_ARB_framebuffer_sRGB */
+/* ------------------------ GL_ARB_geometry_shader4 ------------------------ */
+#ifndef GL_ARB_geometry_shader4
+#define GL_ARB_geometry_shader4 1
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTUREARBPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTUREFACEARBPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURELAYERARBPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer);
+typedef void (GLAPIENTRY * PFNGLPROGRAMPARAMETERIARBPROC) (GLuint program, GLenum pname, GLint value);
+#define glFramebufferTextureARB GLEW_GET_FUN(__glewFramebufferTextureARB)
+#define glFramebufferTextureFaceARB GLEW_GET_FUN(__glewFramebufferTextureFaceARB)
+#define glFramebufferTextureLayerARB GLEW_GET_FUN(__glewFramebufferTextureLayerARB)
+#define glProgramParameteriARB GLEW_GET_FUN(__glewProgramParameteriARB)
+#define GLEW_ARB_geometry_shader4 GLEW_GET_VAR(__GLEW_ARB_geometry_shader4)
+#endif /* GL_ARB_geometry_shader4 */
+/* ----------------------- GL_ARB_get_program_binary ----------------------- */
+#ifndef GL_ARB_get_program_binary
+#define GL_ARB_get_program_binary 1
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMBINARYPROC) (GLuint program, GLsizei bufSize, GLsizei* length, GLenum *binaryFormat, void*binary);
+typedef void (GLAPIENTRY * PFNGLPROGRAMBINARYPROC) (GLuint program, GLenum binaryFormat, const void *binary, GLsizei length);
+typedef void (GLAPIENTRY * PFNGLPROGRAMPARAMETERIPROC) (GLuint program, GLenum pname, GLint value);
+#define glGetProgramBinary GLEW_GET_FUN(__glewGetProgramBinary)
+#define glProgramBinary GLEW_GET_FUN(__glewProgramBinary)
+#define glProgramParameteri GLEW_GET_FUN(__glewProgramParameteri)
+#define GLEW_ARB_get_program_binary GLEW_GET_VAR(__GLEW_ARB_get_program_binary)
+#endif /* GL_ARB_get_program_binary */
+/* ---------------------- GL_ARB_get_texture_sub_image --------------------- */
+#ifndef GL_ARB_get_texture_sub_image
+#define GL_ARB_get_texture_sub_image 1
+typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXTURESUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei bufSize, void *pixels);
+typedef void (GLAPIENTRY * PFNGLGETTEXTURESUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, GLsizei bufSize, void *pixels);
+#define glGetCompressedTextureSubImage GLEW_GET_FUN(__glewGetCompressedTextureSubImage)
+#define glGetTextureSubImage GLEW_GET_FUN(__glewGetTextureSubImage)
+#define GLEW_ARB_get_texture_sub_image GLEW_GET_VAR(__GLEW_ARB_get_texture_sub_image)
+#endif /* GL_ARB_get_texture_sub_image */
+/* ---------------------------- GL_ARB_gl_spirv ---------------------------- */
+#ifndef GL_ARB_gl_spirv
+#define GL_ARB_gl_spirv 1
+#define GL_SPIR_V_BINARY_ARB 0x9552
+typedef void (GLAPIENTRY * PFNGLSPECIALIZESHADERARBPROC) (GLuint shader, const GLchar* pEntryPoint, GLuint numSpecializationConstants, const GLuint* pConstantIndex, const GLuint* pConstantValue);
+#define glSpecializeShaderARB GLEW_GET_FUN(__glewSpecializeShaderARB)
+#define GLEW_ARB_gl_spirv GLEW_GET_VAR(__GLEW_ARB_gl_spirv)
+#endif /* GL_ARB_gl_spirv */
+/* --------------------------- GL_ARB_gpu_shader5 -------------------------- */
+#ifndef GL_ARB_gpu_shader5
+#define GL_ARB_gpu_shader5 1
+#define GLEW_ARB_gpu_shader5 GLEW_GET_VAR(__GLEW_ARB_gpu_shader5)
+#endif /* GL_ARB_gpu_shader5 */
+/* ------------------------- GL_ARB_gpu_shader_fp64 ------------------------ */
+#ifndef GL_ARB_gpu_shader_fp64
+#define GL_ARB_gpu_shader_fp64 1
+#define GL_DOUBLE_MAT2 0x8F46
+#define GL_DOUBLE_MAT3 0x8F47
+#define GL_DOUBLE_MAT4 0x8F48
+#define GL_DOUBLE_MAT2x3 0x8F49
+#define GL_DOUBLE_MAT2x4 0x8F4A
+#define GL_DOUBLE_MAT3x2 0x8F4B
+#define GL_DOUBLE_MAT3x4 0x8F4C
+#define GL_DOUBLE_MAT4x2 0x8F4D
+#define GL_DOUBLE_MAT4x3 0x8F4E
+#define GL_DOUBLE_VEC2 0x8FFC
+#define GL_DOUBLE_VEC3 0x8FFD
+#define GL_DOUBLE_VEC4 0x8FFE
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMDVPROC) (GLuint program, GLint location, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1DPROC) (GLint location, GLdouble x);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1DVPROC) (GLint location, GLsizei count, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2DPROC) (GLint location, GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2DVPROC) (GLint location, GLsizei count, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3DPROC) (GLint location, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3DVPROC) (GLint location, GLsizei count, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4DPROC) (GLint location, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4DVPROC) (GLint location, GLsizei count, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2X3DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2X4DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3X2DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3X4DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4X2DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4X3DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+#define glGetUniformdv GLEW_GET_FUN(__glewGetUniformdv)
+#define glUniform1d GLEW_GET_FUN(__glewUniform1d)
+#define glUniform1dv GLEW_GET_FUN(__glewUniform1dv)
+#define glUniform2d GLEW_GET_FUN(__glewUniform2d)
+#define glUniform2dv GLEW_GET_FUN(__glewUniform2dv)
+#define glUniform3d GLEW_GET_FUN(__glewUniform3d)
+#define glUniform3dv GLEW_GET_FUN(__glewUniform3dv)
+#define glUniform4d GLEW_GET_FUN(__glewUniform4d)
+#define glUniform4dv GLEW_GET_FUN(__glewUniform4dv)
+#define glUniformMatrix2dv GLEW_GET_FUN(__glewUniformMatrix2dv)
+#define glUniformMatrix2x3dv GLEW_GET_FUN(__glewUniformMatrix2x3dv)
+#define glUniformMatrix2x4dv GLEW_GET_FUN(__glewUniformMatrix2x4dv)
+#define glUniformMatrix3dv GLEW_GET_FUN(__glewUniformMatrix3dv)
+#define glUniformMatrix3x2dv GLEW_GET_FUN(__glewUniformMatrix3x2dv)
+#define glUniformMatrix3x4dv GLEW_GET_FUN(__glewUniformMatrix3x4dv)
+#define glUniformMatrix4dv GLEW_GET_FUN(__glewUniformMatrix4dv)
+#define glUniformMatrix4x2dv GLEW_GET_FUN(__glewUniformMatrix4x2dv)
+#define glUniformMatrix4x3dv GLEW_GET_FUN(__glewUniformMatrix4x3dv)
+#define GLEW_ARB_gpu_shader_fp64 GLEW_GET_VAR(__GLEW_ARB_gpu_shader_fp64)
+#endif /* GL_ARB_gpu_shader_fp64 */
+/* ------------------------ GL_ARB_gpu_shader_int64 ------------------------ */
+#ifndef GL_ARB_gpu_shader_int64
+#define GL_ARB_gpu_shader_int64 1
+#define GL_INT64_ARB 0x140E
+#define GL_UNSIGNED_INT64_ARB 0x140F
+#define GL_INT64_VEC2_ARB 0x8FE9
+#define GL_INT64_VEC3_ARB 0x8FEA
+#define GL_INT64_VEC4_ARB 0x8FEB
+#define GL_UNSIGNED_INT64_VEC2_ARB 0x8FF5
+#define GL_UNSIGNED_INT64_VEC3_ARB 0x8FF6
+#define GL_UNSIGNED_INT64_VEC4_ARB 0x8FF7
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMI64VARBPROC) (GLuint program, GLint location, GLint64* params);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMUI64VARBPROC) (GLuint program, GLint location, GLuint64* params);
+typedef void (GLAPIENTRY * PFNGLGETNUNIFORMI64VARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLint64* params);
+typedef void (GLAPIENTRY * PFNGLGETNUNIFORMUI64VARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint64* params);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1I64ARBPROC) (GLuint program, GLint location, GLint64 x);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1UI64ARBPROC) (GLuint program, GLint location, GLuint64 x);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1I64ARBPROC) (GLint location, GLint64 x);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1I64VARBPROC) (GLint location, GLsizei count, const GLint64* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1UI64ARBPROC) (GLint location, GLuint64 x);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1UI64VARBPROC) (GLint location, GLsizei count, const GLuint64* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2I64ARBPROC) (GLint location, GLint64 x, GLint64 y);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2I64VARBPROC) (GLint location, GLsizei count, const GLint64* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2UI64VARBPROC) (GLint location, GLsizei count, const GLuint64* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3I64ARBPROC) (GLint location, GLint64 x, GLint64 y, GLint64 z);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3I64VARBPROC) (GLint location, GLsizei count, const GLint64* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y, GLuint64 z);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3UI64VARBPROC) (GLint location, GLsizei count, const GLuint64* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4I64ARBPROC) (GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4I64VARBPROC) (GLint location, GLsizei count, const GLint64* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4UI64VARBPROC) (GLint location, GLsizei count, const GLuint64* value);
+#define glGetUniformi64vARB GLEW_GET_FUN(__glewGetUniformi64vARB)
+#define glGetUniformui64vARB GLEW_GET_FUN(__glewGetUniformui64vARB)
+#define glGetnUniformi64vARB GLEW_GET_FUN(__glewGetnUniformi64vARB)
+#define glGetnUniformui64vARB GLEW_GET_FUN(__glewGetnUniformui64vARB)
+#define glProgramUniform1i64ARB GLEW_GET_FUN(__glewProgramUniform1i64ARB)
+#define glProgramUniform1i64vARB GLEW_GET_FUN(__glewProgramUniform1i64vARB)
+#define glProgramUniform1ui64ARB GLEW_GET_FUN(__glewProgramUniform1ui64ARB)
+#define glProgramUniform1ui64vARB GLEW_GET_FUN(__glewProgramUniform1ui64vARB)
+#define glProgramUniform2i64ARB GLEW_GET_FUN(__glewProgramUniform2i64ARB)
+#define glProgramUniform2i64vARB GLEW_GET_FUN(__glewProgramUniform2i64vARB)
+#define glProgramUniform2ui64ARB GLEW_GET_FUN(__glewProgramUniform2ui64ARB)
+#define glProgramUniform2ui64vARB GLEW_GET_FUN(__glewProgramUniform2ui64vARB)
+#define glProgramUniform3i64ARB GLEW_GET_FUN(__glewProgramUniform3i64ARB)
+#define glProgramUniform3i64vARB GLEW_GET_FUN(__glewProgramUniform3i64vARB)
+#define glProgramUniform3ui64ARB GLEW_GET_FUN(__glewProgramUniform3ui64ARB)
+#define glProgramUniform3ui64vARB GLEW_GET_FUN(__glewProgramUniform3ui64vARB)
+#define glProgramUniform4i64ARB GLEW_GET_FUN(__glewProgramUniform4i64ARB)
+#define glProgramUniform4i64vARB GLEW_GET_FUN(__glewProgramUniform4i64vARB)
+#define glProgramUniform4ui64ARB GLEW_GET_FUN(__glewProgramUniform4ui64ARB)
+#define glProgramUniform4ui64vARB GLEW_GET_FUN(__glewProgramUniform4ui64vARB)
+#define glUniform1i64ARB GLEW_GET_FUN(__glewUniform1i64ARB)
+#define glUniform1i64vARB GLEW_GET_FUN(__glewUniform1i64vARB)
+#define glUniform1ui64ARB GLEW_GET_FUN(__glewUniform1ui64ARB)
+#define glUniform1ui64vARB GLEW_GET_FUN(__glewUniform1ui64vARB)
+#define glUniform2i64ARB GLEW_GET_FUN(__glewUniform2i64ARB)
+#define glUniform2i64vARB GLEW_GET_FUN(__glewUniform2i64vARB)
+#define glUniform2ui64ARB GLEW_GET_FUN(__glewUniform2ui64ARB)
+#define glUniform2ui64vARB GLEW_GET_FUN(__glewUniform2ui64vARB)
+#define glUniform3i64ARB GLEW_GET_FUN(__glewUniform3i64ARB)
+#define glUniform3i64vARB GLEW_GET_FUN(__glewUniform3i64vARB)
+#define glUniform3ui64ARB GLEW_GET_FUN(__glewUniform3ui64ARB)
+#define glUniform3ui64vARB GLEW_GET_FUN(__glewUniform3ui64vARB)
+#define glUniform4i64ARB GLEW_GET_FUN(__glewUniform4i64ARB)
+#define glUniform4i64vARB GLEW_GET_FUN(__glewUniform4i64vARB)
+#define glUniform4ui64ARB GLEW_GET_FUN(__glewUniform4ui64ARB)
+#define glUniform4ui64vARB GLEW_GET_FUN(__glewUniform4ui64vARB)
+#define GLEW_ARB_gpu_shader_int64 GLEW_GET_VAR(__GLEW_ARB_gpu_shader_int64)
+#endif /* GL_ARB_gpu_shader_int64 */
+/* ------------------------ GL_ARB_half_float_pixel ------------------------ */
+#ifndef GL_ARB_half_float_pixel
+#define GL_ARB_half_float_pixel 1
+#define GL_HALF_FLOAT_ARB 0x140B
+#define GLEW_ARB_half_float_pixel GLEW_GET_VAR(__GLEW_ARB_half_float_pixel)
+#endif /* GL_ARB_half_float_pixel */
+/* ------------------------ GL_ARB_half_float_vertex ----------------------- */
+#ifndef GL_ARB_half_float_vertex
+#define GL_ARB_half_float_vertex 1
+#define GL_HALF_FLOAT 0x140B
+#define GLEW_ARB_half_float_vertex GLEW_GET_VAR(__GLEW_ARB_half_float_vertex)
+#endif /* GL_ARB_half_float_vertex */
+/* ----------------------------- GL_ARB_imaging ---------------------------- */
+#ifndef GL_ARB_imaging
+#define GL_ARB_imaging 1
+#define GL_CONSTANT_COLOR 0x8001
+#define GL_CONSTANT_ALPHA 0x8003
+#define GL_BLEND_COLOR 0x8005
+#define GL_FUNC_ADD 0x8006
+#define GL_MIN 0x8007
+#define GL_MAX 0x8008
+#define GL_BLEND_EQUATION 0x8009
+#define GL_FUNC_SUBTRACT 0x800A
+#define GL_CONVOLUTION_1D 0x8010
+#define GL_CONVOLUTION_2D 0x8011
+#define GL_SEPARABLE_2D 0x8012
+#define GL_REDUCE 0x8016
+#define GL_CONVOLUTION_WIDTH 0x8018
+#define GL_HISTOGRAM 0x8024
+#define GL_PROXY_HISTOGRAM 0x8025
+#define GL_HISTOGRAM_WIDTH 0x8026
+#define GL_HISTOGRAM_FORMAT 0x8027
+#define GL_HISTOGRAM_RED_SIZE 0x8028
+#define GL_HISTOGRAM_SINK 0x802D
+#define GL_MINMAX 0x802E
+#define GL_MINMAX_FORMAT 0x802F
+#define GL_MINMAX_SINK 0x8030
+#define GL_TABLE_TOO_LARGE 0x8031
+#define GL_COLOR_MATRIX 0x80B1
+#define GL_COLOR_TABLE 0x80D0
+#define GL_PROXY_COLOR_TABLE 0x80D3
+#define GL_COLOR_TABLE_SCALE 0x80D6
+#define GL_COLOR_TABLE_BIAS 0x80D7
+#define GL_COLOR_TABLE_WIDTH 0x80D9
+#define GL_IGNORE_BORDER 0x8150
+#define GL_CONSTANT_BORDER 0x8151
+#define GL_WRAP_BORDER 0x8152
+#define GL_REPLICATE_BORDER 0x8153
+typedef void (GLAPIENTRY * PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *table);
+typedef void (GLAPIENTRY * PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *image);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *image);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (GLAPIENTRY * PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, void *table);
+typedef void (GLAPIENTRY * PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (GLAPIENTRY * PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, void *image);
+typedef void (GLAPIENTRY * PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (GLAPIENTRY * PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values);
+typedef void (GLAPIENTRY * PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (GLAPIENTRY * PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum types, void *values);
+typedef void (GLAPIENTRY * PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (GLAPIENTRY * PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, void *row, void *column, void *span);
+typedef void (GLAPIENTRY * PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink);
+typedef void (GLAPIENTRY * PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, GLboolean sink);
+typedef void (GLAPIENTRY * PFNGLRESETMINMAXPROC) (GLenum target);
+typedef void (GLAPIENTRY * PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *row, const void *column);
+#define glColorSubTable GLEW_GET_FUN(__glewColorSubTable)
+#define glColorTable GLEW_GET_FUN(__glewColorTable)
+#define glColorTableParameterfv GLEW_GET_FUN(__glewColorTableParameterfv)
+#define glColorTableParameteriv GLEW_GET_FUN(__glewColorTableParameteriv)
+#define glConvolutionFilter1D GLEW_GET_FUN(__glewConvolutionFilter1D)
+#define glConvolutionFilter2D GLEW_GET_FUN(__glewConvolutionFilter2D)
+#define glConvolutionParameterf GLEW_GET_FUN(__glewConvolutionParameterf)
+#define glConvolutionParameterfv GLEW_GET_FUN(__glewConvolutionParameterfv)
+#define glConvolutionParameteri GLEW_GET_FUN(__glewConvolutionParameteri)
+#define glConvolutionParameteriv GLEW_GET_FUN(__glewConvolutionParameteriv)
+#define glCopyColorSubTable GLEW_GET_FUN(__glewCopyColorSubTable)
+#define glCopyColorTable GLEW_GET_FUN(__glewCopyColorTable)
+#define glCopyConvolutionFilter1D GLEW_GET_FUN(__glewCopyConvolutionFilter1D)
+#define glCopyConvolutionFilter2D GLEW_GET_FUN(__glewCopyConvolutionFilter2D)
+#define glGetColorTable GLEW_GET_FUN(__glewGetColorTable)
+#define glGetColorTableParameterfv GLEW_GET_FUN(__glewGetColorTableParameterfv)
+#define glGetColorTableParameteriv GLEW_GET_FUN(__glewGetColorTableParameteriv)
+#define glGetConvolutionFilter GLEW_GET_FUN(__glewGetConvolutionFilter)
+#define glGetConvolutionParameterfv GLEW_GET_FUN(__glewGetConvolutionParameterfv)
+#define glGetConvolutionParameteriv GLEW_GET_FUN(__glewGetConvolutionParameteriv)
+#define glGetHistogram GLEW_GET_FUN(__glewGetHistogram)
+#define glGetHistogramParameterfv GLEW_GET_FUN(__glewGetHistogramParameterfv)
+#define glGetHistogramParameteriv GLEW_GET_FUN(__glewGetHistogramParameteriv)
+#define glGetMinmax GLEW_GET_FUN(__glewGetMinmax)
+#define glGetMinmaxParameterfv GLEW_GET_FUN(__glewGetMinmaxParameterfv)
+#define glGetMinmaxParameteriv GLEW_GET_FUN(__glewGetMinmaxParameteriv)
+#define glGetSeparableFilter GLEW_GET_FUN(__glewGetSeparableFilter)
+#define glHistogram GLEW_GET_FUN(__glewHistogram)
+#define glMinmax GLEW_GET_FUN(__glewMinmax)
+#define glResetHistogram GLEW_GET_FUN(__glewResetHistogram)
+#define glResetMinmax GLEW_GET_FUN(__glewResetMinmax)
+#define glSeparableFilter2D GLEW_GET_FUN(__glewSeparableFilter2D)
+#define GLEW_ARB_imaging GLEW_GET_VAR(__GLEW_ARB_imaging)
+#endif /* GL_ARB_imaging */
+/* ----------------------- GL_ARB_indirect_parameters ---------------------- */
+#ifndef GL_ARB_indirect_parameters
+#define GL_ARB_indirect_parameters 1
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWARRAYSINDIRECTCOUNTARBPROC) (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTARBPROC) (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride);
+#define glMultiDrawArraysIndirectCountARB GLEW_GET_FUN(__glewMultiDrawArraysIndirectCountARB)
+#define glMultiDrawElementsIndirectCountARB GLEW_GET_FUN(__glewMultiDrawElementsIndirectCountARB)
+#define GLEW_ARB_indirect_parameters GLEW_GET_VAR(__GLEW_ARB_indirect_parameters)
+#endif /* GL_ARB_indirect_parameters */
+/* ------------------------ GL_ARB_instanced_arrays ------------------------ */
+#ifndef GL_ARB_instanced_arrays
+#define GL_ARB_instanced_arrays 1
+typedef void (GLAPIENTRY * PFNGLDRAWARRAYSINSTANCEDARBPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDARBPROC) (GLenum mode, GLsizei count, GLenum type, const void* indices, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBDIVISORARBPROC) (GLuint index, GLuint divisor);
+#define glDrawArraysInstancedARB GLEW_GET_FUN(__glewDrawArraysInstancedARB)
+#define glDrawElementsInstancedARB GLEW_GET_FUN(__glewDrawElementsInstancedARB)
+#define glVertexAttribDivisorARB GLEW_GET_FUN(__glewVertexAttribDivisorARB)
+#define GLEW_ARB_instanced_arrays GLEW_GET_VAR(__GLEW_ARB_instanced_arrays)
+#endif /* GL_ARB_instanced_arrays */
+/* ---------------------- GL_ARB_internalformat_query ---------------------- */
+#ifndef GL_ARB_internalformat_query
+#define GL_ARB_internalformat_query 1
+#define GL_NUM_SAMPLE_COUNTS 0x9380
+typedef void (GLAPIENTRY * PFNGLGETINTERNALFORMATIVPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint* params);
+#define glGetInternalformativ GLEW_GET_FUN(__glewGetInternalformativ)
+#define GLEW_ARB_internalformat_query GLEW_GET_VAR(__GLEW_ARB_internalformat_query)
+#endif /* GL_ARB_internalformat_query */
+/* ---------------------- GL_ARB_internalformat_query2 --------------------- */
+#ifndef GL_ARB_internalformat_query2
+#define GL_ARB_internalformat_query2 1
+#define GL_MAX_WIDTH 0x827E
+#define GL_MAX_HEIGHT 0x827F
+#define GL_MAX_DEPTH 0x8280
+#define GL_MAX_LAYERS 0x8281
+#define GL_COLOR_COMPONENTS 0x8283
+#define GL_DEPTH_COMPONENTS 0x8284
+#define GL_COLOR_RENDERABLE 0x8286
+#define GL_DEPTH_RENDERABLE 0x8287
+#define GL_READ_PIXELS 0x828C
+#define GL_READ_PIXELS_TYPE 0x828E
+#define GL_TEXTURE_IMAGE_TYPE 0x8290
+#define GL_MIPMAP 0x8293
+#define GL_COLOR_ENCODING 0x8296
+#define GL_SRGB_READ 0x8297
+#define GL_SRGB_WRITE 0x8298
+#define GL_SRGB_DECODE_ARB 0x8299
+#define GL_FILTER 0x829A
+#define GL_VERTEX_TEXTURE 0x829B
+#define GL_COMPUTE_TEXTURE 0x82A0
+#define GL_TEXTURE_SHADOW 0x82A1
+#define GL_TEXTURE_GATHER 0x82A2
+#define GL_SHADER_IMAGE_LOAD 0x82A4
+#define GL_IMAGE_TEXEL_SIZE 0x82A7
+#define GL_CLEAR_BUFFER 0x82B4
+#define GL_TEXTURE_VIEW 0x82B5
+#define GL_FULL_SUPPORT 0x82B7
+#define GL_CAVEAT_SUPPORT 0x82B8
+#define GL_IMAGE_CLASS_4_X_32 0x82B9
+#define GL_IMAGE_CLASS_2_X_32 0x82BA
+#define GL_IMAGE_CLASS_1_X_32 0x82BB
+#define GL_IMAGE_CLASS_4_X_16 0x82BC
+#define GL_IMAGE_CLASS_2_X_16 0x82BD
+#define GL_IMAGE_CLASS_1_X_16 0x82BE
+#define GL_IMAGE_CLASS_4_X_8 0x82BF
+#define GL_IMAGE_CLASS_2_X_8 0x82C0
+#define GL_IMAGE_CLASS_1_X_8 0x82C1
+#define GL_IMAGE_CLASS_11_11_10 0x82C2
+#define GL_IMAGE_CLASS_10_10_10_2 0x82C3
+#define GL_VIEW_CLASS_128_BITS 0x82C4
+#define GL_VIEW_CLASS_96_BITS 0x82C5
+#define GL_VIEW_CLASS_64_BITS 0x82C6
+#define GL_VIEW_CLASS_48_BITS 0x82C7
+#define GL_VIEW_CLASS_32_BITS 0x82C8
+#define GL_VIEW_CLASS_24_BITS 0x82C9
+#define GL_VIEW_CLASS_16_BITS 0x82CA
+#define GL_VIEW_CLASS_8_BITS 0x82CB
+#define GL_VIEW_CLASS_RGTC1_RED 0x82D0
+#define GL_VIEW_CLASS_RGTC2_RG 0x82D1
+typedef void (GLAPIENTRY * PFNGLGETINTERNALFORMATI64VPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64* params);
+#define glGetInternalformati64v GLEW_GET_FUN(__glewGetInternalformati64v)
+#define GLEW_ARB_internalformat_query2 GLEW_GET_VAR(__GLEW_ARB_internalformat_query2)
+#endif /* GL_ARB_internalformat_query2 */
+/* ----------------------- GL_ARB_invalidate_subdata ----------------------- */
+#ifndef GL_ARB_invalidate_subdata
+#define GL_ARB_invalidate_subdata 1
+typedef void (GLAPIENTRY * PFNGLINVALIDATEBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length);
+typedef void (GLAPIENTRY * PFNGLINVALIDATEFRAMEBUFFERPROC) (GLenum target, GLsizei numAttachments, const GLenum* attachments);
+typedef void (GLAPIENTRY * PFNGLINVALIDATESUBFRAMEBUFFERPROC) (GLenum target, GLsizei numAttachments, const GLenum* attachments, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLINVALIDATETEXIMAGEPROC) (GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLINVALIDATETEXSUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth);
+#define glInvalidateBufferData GLEW_GET_FUN(__glewInvalidateBufferData)
+#define glInvalidateBufferSubData GLEW_GET_FUN(__glewInvalidateBufferSubData)
+#define glInvalidateFramebuffer GLEW_GET_FUN(__glewInvalidateFramebuffer)
+#define glInvalidateSubFramebuffer GLEW_GET_FUN(__glewInvalidateSubFramebuffer)
+#define glInvalidateTexImage GLEW_GET_FUN(__glewInvalidateTexImage)
+#define glInvalidateTexSubImage GLEW_GET_FUN(__glewInvalidateTexSubImage)
+#define GLEW_ARB_invalidate_subdata GLEW_GET_VAR(__GLEW_ARB_invalidate_subdata)
+#endif /* GL_ARB_invalidate_subdata */
+/* ---------------------- GL_ARB_map_buffer_alignment ---------------------- */
+#ifndef GL_ARB_map_buffer_alignment
+#define GL_ARB_map_buffer_alignment 1
+#define GLEW_ARB_map_buffer_alignment GLEW_GET_VAR(__GLEW_ARB_map_buffer_alignment)
+#endif /* GL_ARB_map_buffer_alignment */
+/* ------------------------ GL_ARB_map_buffer_range ------------------------ */
+#ifndef GL_ARB_map_buffer_range
+#define GL_ARB_map_buffer_range 1
+#define GL_MAP_READ_BIT 0x0001
+#define GL_MAP_WRITE_BIT 0x0002
+typedef void (GLAPIENTRY * PFNGLFLUSHMAPPEDBUFFERRANGEPROC) (GLenum target, GLintptr offset, GLsizeiptr length);
+typedef void * (GLAPIENTRY * PFNGLMAPBUFFERRANGEPROC) (GLenum target, GLintptr offset, GLsizeiptr length, GLbitfield access);
+#define glFlushMappedBufferRange GLEW_GET_FUN(__glewFlushMappedBufferRange)
+#define glMapBufferRange GLEW_GET_FUN(__glewMapBufferRange)
+#define GLEW_ARB_map_buffer_range GLEW_GET_VAR(__GLEW_ARB_map_buffer_range)
+#endif /* GL_ARB_map_buffer_range */
+/* ------------------------- GL_ARB_matrix_palette ------------------------- */
+#ifndef GL_ARB_matrix_palette
+#define GL_ARB_matrix_palette 1
+#define GL_MATRIX_PALETTE_ARB 0x8840
+typedef void (GLAPIENTRY * PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, void *pointer);
+typedef void (GLAPIENTRY * PFNGLMATRIXINDEXUBVARBPROC) (GLint size, GLubyte *indices);
+typedef void (GLAPIENTRY * PFNGLMATRIXINDEXUIVARBPROC) (GLint size, GLuint *indices);
+typedef void (GLAPIENTRY * PFNGLMATRIXINDEXUSVARBPROC) (GLint size, GLushort *indices);
+#define glCurrentPaletteMatrixARB GLEW_GET_FUN(__glewCurrentPaletteMatrixARB)
+#define glMatrixIndexPointerARB GLEW_GET_FUN(__glewMatrixIndexPointerARB)
+#define glMatrixIndexubvARB GLEW_GET_FUN(__glewMatrixIndexubvARB)
+#define glMatrixIndexuivARB GLEW_GET_FUN(__glewMatrixIndexuivARB)
+#define glMatrixIndexusvARB GLEW_GET_FUN(__glewMatrixIndexusvARB)
+#define GLEW_ARB_matrix_palette GLEW_GET_VAR(__GLEW_ARB_matrix_palette)
+#endif /* GL_ARB_matrix_palette */
+/* --------------------------- GL_ARB_multi_bind --------------------------- */
+#ifndef GL_ARB_multi_bind
+#define GL_ARB_multi_bind 1
+typedef void (GLAPIENTRY * PFNGLBINDBUFFERSBASEPROC) (GLenum target, GLuint first, GLsizei count, const GLuint* buffers);
+typedef void (GLAPIENTRY * PFNGLBINDBUFFERSRANGEPROC) (GLenum target, GLuint first, GLsizei count, const GLuint* buffers, const GLintptr *offsets, const GLsizeiptr *sizes);
+typedef void (GLAPIENTRY * PFNGLBINDIMAGETEXTURESPROC) (GLuint first, GLsizei count, const GLuint* textures);
+typedef void (GLAPIENTRY * PFNGLBINDSAMPLERSPROC) (GLuint first, GLsizei count, const GLuint* samplers);
+typedef void (GLAPIENTRY * PFNGLBINDTEXTURESPROC) (GLuint first, GLsizei count, const GLuint* textures);
+typedef void (GLAPIENTRY * PFNGLBINDVERTEXBUFFERSPROC) (GLuint first, GLsizei count, const GLuint* buffers, const GLintptr *offsets, const GLsizei *strides);
+#define glBindBuffersBase GLEW_GET_FUN(__glewBindBuffersBase)
+#define glBindBuffersRange GLEW_GET_FUN(__glewBindBuffersRange)
+#define glBindImageTextures GLEW_GET_FUN(__glewBindImageTextures)
+#define glBindSamplers GLEW_GET_FUN(__glewBindSamplers)
+#define glBindTextures GLEW_GET_FUN(__glewBindTextures)
+#define glBindVertexBuffers GLEW_GET_FUN(__glewBindVertexBuffers)
+#define GLEW_ARB_multi_bind GLEW_GET_VAR(__GLEW_ARB_multi_bind)
+#endif /* GL_ARB_multi_bind */
+/* ----------------------- GL_ARB_multi_draw_indirect ---------------------- */
+#ifndef GL_ARB_multi_draw_indirect
+#define GL_ARB_multi_draw_indirect 1
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWARRAYSINDIRECTPROC) (GLenum mode, const void *indirect, GLsizei primcount, GLsizei stride);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei primcount, GLsizei stride);
+#define glMultiDrawArraysIndirect GLEW_GET_FUN(__glewMultiDrawArraysIndirect)
+#define glMultiDrawElementsIndirect GLEW_GET_FUN(__glewMultiDrawElementsIndirect)
+#define GLEW_ARB_multi_draw_indirect GLEW_GET_VAR(__GLEW_ARB_multi_draw_indirect)
+#endif /* GL_ARB_multi_draw_indirect */
+/* --------------------------- GL_ARB_multisample -------------------------- */
+#ifndef GL_ARB_multisample
+#define GL_ARB_multisample 1
+#define GL_MULTISAMPLE_ARB 0x809D
+#define GL_SAMPLES_ARB 0x80A9
+#define GL_MULTISAMPLE_BIT_ARB 0x20000000
+typedef void (GLAPIENTRY * PFNGLSAMPLECOVERAGEARBPROC) (GLclampf value, GLboolean invert);
+#define glSampleCoverageARB GLEW_GET_FUN(__glewSampleCoverageARB)
+#define GLEW_ARB_multisample GLEW_GET_VAR(__GLEW_ARB_multisample)
+#endif /* GL_ARB_multisample */
+/* -------------------------- GL_ARB_multitexture -------------------------- */
+#ifndef GL_ARB_multitexture
+#define GL_ARB_multitexture 1
+#define GL_TEXTURE0_ARB 0x84C0
+#define GL_TEXTURE1_ARB 0x84C1
+#define GL_TEXTURE2_ARB 0x84C2
+#define GL_TEXTURE3_ARB 0x84C3
+#define GL_TEXTURE4_ARB 0x84C4
+#define GL_TEXTURE5_ARB 0x84C5
+#define GL_TEXTURE6_ARB 0x84C6
+#define GL_TEXTURE7_ARB 0x84C7
+#define GL_TEXTURE8_ARB 0x84C8
+#define GL_TEXTURE9_ARB 0x84C9
+#define GL_TEXTURE10_ARB 0x84CA
+#define GL_TEXTURE11_ARB 0x84CB
+#define GL_TEXTURE12_ARB 0x84CC
+#define GL_TEXTURE13_ARB 0x84CD
+#define GL_TEXTURE14_ARB 0x84CE
+#define GL_TEXTURE15_ARB 0x84CF
+#define GL_TEXTURE16_ARB 0x84D0
+#define GL_TEXTURE17_ARB 0x84D1
+#define GL_TEXTURE18_ARB 0x84D2
+#define GL_TEXTURE19_ARB 0x84D3
+#define GL_TEXTURE20_ARB 0x84D4
+#define GL_TEXTURE21_ARB 0x84D5
+#define GL_TEXTURE22_ARB 0x84D6
+#define GL_TEXTURE23_ARB 0x84D7
+#define GL_TEXTURE24_ARB 0x84D8
+#define GL_TEXTURE25_ARB 0x84D9
+#define GL_TEXTURE26_ARB 0x84DA
+#define GL_TEXTURE27_ARB 0x84DB
+#define GL_TEXTURE28_ARB 0x84DC
+#define GL_TEXTURE29_ARB 0x84DD
+#define GL_TEXTURE30_ARB 0x84DE
+#define GL_TEXTURE31_ARB 0x84DF
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1DARBPROC) (GLenum target, GLdouble s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1FARBPROC) (GLenum target, GLfloat s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1IARBPROC) (GLenum target, GLint s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1IVARBPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1SARBPROC) (GLenum target, GLshort s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2DARBPROC) (GLenum target, GLdouble s, GLdouble t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2FARBPROC) (GLenum target, GLfloat s, GLfloat t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2IARBPROC) (GLenum target, GLint s, GLint t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2IVARBPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2SARBPROC) (GLenum target, GLshort s, GLshort t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3IARBPROC) (GLenum target, GLint s, GLint t, GLint r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3IVARBPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4IARBPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4IVARBPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4SVARBPROC) (GLenum target, const GLshort *v);
+#define glActiveTextureARB GLEW_GET_FUN(__glewActiveTextureARB)
+#define glClientActiveTextureARB GLEW_GET_FUN(__glewClientActiveTextureARB)
+#define glMultiTexCoord1dARB GLEW_GET_FUN(__glewMultiTexCoord1dARB)
+#define glMultiTexCoord1dvARB GLEW_GET_FUN(__glewMultiTexCoord1dvARB)
+#define glMultiTexCoord1fARB GLEW_GET_FUN(__glewMultiTexCoord1fARB)
+#define glMultiTexCoord1fvARB GLEW_GET_FUN(__glewMultiTexCoord1fvARB)
+#define glMultiTexCoord1iARB GLEW_GET_FUN(__glewMultiTexCoord1iARB)
+#define glMultiTexCoord1ivARB GLEW_GET_FUN(__glewMultiTexCoord1ivARB)
+#define glMultiTexCoord1sARB GLEW_GET_FUN(__glewMultiTexCoord1sARB)
+#define glMultiTexCoord1svARB GLEW_GET_FUN(__glewMultiTexCoord1svARB)
+#define glMultiTexCoord2dARB GLEW_GET_FUN(__glewMultiTexCoord2dARB)
+#define glMultiTexCoord2dvARB GLEW_GET_FUN(__glewMultiTexCoord2dvARB)
+#define glMultiTexCoord2fARB GLEW_GET_FUN(__glewMultiTexCoord2fARB)
+#define glMultiTexCoord2fvARB GLEW_GET_FUN(__glewMultiTexCoord2fvARB)
+#define glMultiTexCoord2iARB GLEW_GET_FUN(__glewMultiTexCoord2iARB)
+#define glMultiTexCoord2ivARB GLEW_GET_FUN(__glewMultiTexCoord2ivARB)
+#define glMultiTexCoord2sARB GLEW_GET_FUN(__glewMultiTexCoord2sARB)
+#define glMultiTexCoord2svARB GLEW_GET_FUN(__glewMultiTexCoord2svARB)
+#define glMultiTexCoord3dARB GLEW_GET_FUN(__glewMultiTexCoord3dARB)
+#define glMultiTexCoord3dvARB GLEW_GET_FUN(__glewMultiTexCoord3dvARB)
+#define glMultiTexCoord3fARB GLEW_GET_FUN(__glewMultiTexCoord3fARB)
+#define glMultiTexCoord3fvARB GLEW_GET_FUN(__glewMultiTexCoord3fvARB)
+#define glMultiTexCoord3iARB GLEW_GET_FUN(__glewMultiTexCoord3iARB)
+#define glMultiTexCoord3ivARB GLEW_GET_FUN(__glewMultiTexCoord3ivARB)
+#define glMultiTexCoord3sARB GLEW_GET_FUN(__glewMultiTexCoord3sARB)
+#define glMultiTexCoord3svARB GLEW_GET_FUN(__glewMultiTexCoord3svARB)
+#define glMultiTexCoord4dARB GLEW_GET_FUN(__glewMultiTexCoord4dARB)
+#define glMultiTexCoord4dvARB GLEW_GET_FUN(__glewMultiTexCoord4dvARB)
+#define glMultiTexCoord4fARB GLEW_GET_FUN(__glewMultiTexCoord4fARB)
+#define glMultiTexCoord4fvARB GLEW_GET_FUN(__glewMultiTexCoord4fvARB)
+#define glMultiTexCoord4iARB GLEW_GET_FUN(__glewMultiTexCoord4iARB)
+#define glMultiTexCoord4ivARB GLEW_GET_FUN(__glewMultiTexCoord4ivARB)
+#define glMultiTexCoord4sARB GLEW_GET_FUN(__glewMultiTexCoord4sARB)
+#define glMultiTexCoord4svARB GLEW_GET_FUN(__glewMultiTexCoord4svARB)
+#define GLEW_ARB_multitexture GLEW_GET_VAR(__GLEW_ARB_multitexture)
+#endif /* GL_ARB_multitexture */
+/* ------------------------- GL_ARB_occlusion_query ------------------------ */
+#ifndef GL_ARB_occlusion_query
+#define GL_ARB_occlusion_query 1
+#define GL_CURRENT_QUERY_ARB 0x8865
+#define GL_QUERY_RESULT_ARB 0x8866
+#define GL_SAMPLES_PASSED_ARB 0x8914
+typedef void (GLAPIENTRY * PFNGLBEGINQUERYARBPROC) (GLenum target, GLuint id);
+typedef void (GLAPIENTRY * PFNGLDELETEQUERIESARBPROC) (GLsizei n, const GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLENDQUERYARBPROC) (GLenum target);
+typedef void (GLAPIENTRY * PFNGLGENQUERIESARBPROC) (GLsizei n, GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTIVARBPROC) (GLuint id, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTUIVARBPROC) (GLuint id, GLenum pname, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYIVARBPROC) (GLenum target, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISQUERYARBPROC) (GLuint id);
+#define glBeginQueryARB GLEW_GET_FUN(__glewBeginQueryARB)
+#define glDeleteQueriesARB GLEW_GET_FUN(__glewDeleteQueriesARB)
+#define glEndQueryARB GLEW_GET_FUN(__glewEndQueryARB)
+#define glGenQueriesARB GLEW_GET_FUN(__glewGenQueriesARB)
+#define glGetQueryObjectivARB GLEW_GET_FUN(__glewGetQueryObjectivARB)
+#define glGetQueryObjectuivARB GLEW_GET_FUN(__glewGetQueryObjectuivARB)
+#define glGetQueryivARB GLEW_GET_FUN(__glewGetQueryivARB)
+#define glIsQueryARB GLEW_GET_FUN(__glewIsQueryARB)
+#define GLEW_ARB_occlusion_query GLEW_GET_VAR(__GLEW_ARB_occlusion_query)
+#endif /* GL_ARB_occlusion_query */
+/* ------------------------ GL_ARB_occlusion_query2 ------------------------ */
+#ifndef GL_ARB_occlusion_query2
+#define GL_ARB_occlusion_query2 1
+#define GLEW_ARB_occlusion_query2 GLEW_GET_VAR(__GLEW_ARB_occlusion_query2)
+#endif /* GL_ARB_occlusion_query2 */
+/* --------------------- GL_ARB_parallel_shader_compile -------------------- */
+#ifndef GL_ARB_parallel_shader_compile
+#define GL_ARB_parallel_shader_compile 1
+#define glMaxShaderCompilerThreadsARB GLEW_GET_FUN(__glewMaxShaderCompilerThreadsARB)
+#define GLEW_ARB_parallel_shader_compile GLEW_GET_VAR(__GLEW_ARB_parallel_shader_compile)
+#endif /* GL_ARB_parallel_shader_compile */
+/* -------------------- GL_ARB_pipeline_statistics_query ------------------- */
+#ifndef GL_ARB_pipeline_statistics_query
+#define GL_ARB_pipeline_statistics_query 1
+#define GLEW_ARB_pipeline_statistics_query GLEW_GET_VAR(__GLEW_ARB_pipeline_statistics_query)
+#endif /* GL_ARB_pipeline_statistics_query */
+/* ----------------------- GL_ARB_pixel_buffer_object ---------------------- */
+#ifndef GL_ARB_pixel_buffer_object
+#define GL_ARB_pixel_buffer_object 1
+#define GLEW_ARB_pixel_buffer_object GLEW_GET_VAR(__GLEW_ARB_pixel_buffer_object)
+#endif /* GL_ARB_pixel_buffer_object */
+/* ------------------------ GL_ARB_point_parameters ------------------------ */
+#ifndef GL_ARB_point_parameters
+#define GL_ARB_point_parameters 1
+#define GL_POINT_SIZE_MIN_ARB 0x8126
+#define GL_POINT_SIZE_MAX_ARB 0x8127
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERFARBPROC) (GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERFVARBPROC) (GLenum pname, const GLfloat* params);
+#define glPointParameterfARB GLEW_GET_FUN(__glewPointParameterfARB)
+#define glPointParameterfvARB GLEW_GET_FUN(__glewPointParameterfvARB)
+#define GLEW_ARB_point_parameters GLEW_GET_VAR(__GLEW_ARB_point_parameters)
+#endif /* GL_ARB_point_parameters */
+/* -------------------------- GL_ARB_point_sprite -------------------------- */
+#ifndef GL_ARB_point_sprite
+#define GL_ARB_point_sprite 1
+#define GL_POINT_SPRITE_ARB 0x8861
+#define GL_COORD_REPLACE_ARB 0x8862
+#define GLEW_ARB_point_sprite GLEW_GET_VAR(__GLEW_ARB_point_sprite)
+#endif /* GL_ARB_point_sprite */
+/* ---------------------- GL_ARB_polygon_offset_clamp ---------------------- */
+#ifndef GL_ARB_polygon_offset_clamp
+#define GL_ARB_polygon_offset_clamp 1
+typedef void (GLAPIENTRY * PFNGLPOLYGONOFFSETCLAMPPROC) (GLfloat factor, GLfloat units, GLfloat clamp);
+#define glPolygonOffsetClamp GLEW_GET_FUN(__glewPolygonOffsetClamp)
+#define GLEW_ARB_polygon_offset_clamp GLEW_GET_VAR(__GLEW_ARB_polygon_offset_clamp)
+#endif /* GL_ARB_polygon_offset_clamp */
+/* ----------------------- GL_ARB_post_depth_coverage ---------------------- */
+#ifndef GL_ARB_post_depth_coverage
+#define GL_ARB_post_depth_coverage 1
+#define GLEW_ARB_post_depth_coverage GLEW_GET_VAR(__GLEW_ARB_post_depth_coverage)
+#endif /* GL_ARB_post_depth_coverage */
+/* --------------------- GL_ARB_program_interface_query -------------------- */
+#ifndef GL_ARB_program_interface_query
+#define GL_ARB_program_interface_query 1
+#define GL_UNIFORM 0x92E1
+#define GL_UNIFORM_BLOCK 0x92E2
+#define GL_PROGRAM_INPUT 0x92E3
+#define GL_PROGRAM_OUTPUT 0x92E4
+#define GL_BUFFER_VARIABLE 0x92E5
+#define GL_IS_PER_PATCH 0x92E7
+#define GL_MAX_NAME_LENGTH 0x92F6
+#define GL_NAME_LENGTH 0x92F9
+#define GL_TYPE 0x92FA
+#define GL_ARRAY_SIZE 0x92FB
+#define GL_OFFSET 0x92FC
+#define GL_BLOCK_INDEX 0x92FD
+#define GL_ARRAY_STRIDE 0x92FE
+#define GL_MATRIX_STRIDE 0x92FF
+#define GL_IS_ROW_MAJOR 0x9300
+#define GL_BUFFER_BINDING 0x9302
+#define GL_BUFFER_DATA_SIZE 0x9303
+#define GL_ACTIVE_VARIABLES 0x9305
+#define GL_LOCATION 0x930E
+#define GL_LOCATION_INDEX 0x930F
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMINTERFACEIVPROC) (GLuint program, GLenum programInterface, GLenum pname, GLint* params);
+typedef GLuint (GLAPIENTRY * PFNGLGETPROGRAMRESOURCEINDEXPROC) (GLuint program, GLenum programInterface, const GLchar* name);
+typedef GLint (GLAPIENTRY * PFNGLGETPROGRAMRESOURCELOCATIONPROC) (GLuint program, GLenum programInterface, const GLchar* name);
+typedef GLint (GLAPIENTRY * PFNGLGETPROGRAMRESOURCELOCATIONINDEXPROC) (GLuint program, GLenum programInterface, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMRESOURCENAMEPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei bufSize, GLsizei* length, GLchar *name);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMRESOURCEIVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum* props, GLsizei bufSize, GLsizei *length, GLint *params);
+#define glGetProgramInterfaceiv GLEW_GET_FUN(__glewGetProgramInterfaceiv)
+#define glGetProgramResourceIndex GLEW_GET_FUN(__glewGetProgramResourceIndex)
+#define glGetProgramResourceLocation GLEW_GET_FUN(__glewGetProgramResourceLocation)
+#define glGetProgramResourceLocationIndex GLEW_GET_FUN(__glewGetProgramResourceLocationIndex)
+#define glGetProgramResourceName GLEW_GET_FUN(__glewGetProgramResourceName)
+#define glGetProgramResourceiv GLEW_GET_FUN(__glewGetProgramResourceiv)
+#define GLEW_ARB_program_interface_query GLEW_GET_VAR(__GLEW_ARB_program_interface_query)
+#endif /* GL_ARB_program_interface_query */
+/* ------------------------ GL_ARB_provoking_vertex ------------------------ */
+#ifndef GL_ARB_provoking_vertex
+#define GL_ARB_provoking_vertex 1
+#define glProvokingVertex GLEW_GET_FUN(__glewProvokingVertex)
+#define GLEW_ARB_provoking_vertex GLEW_GET_VAR(__GLEW_ARB_provoking_vertex)
+#endif /* GL_ARB_provoking_vertex */
+/* ----------------------- GL_ARB_query_buffer_object ---------------------- */
+#ifndef GL_ARB_query_buffer_object
+#define GL_ARB_query_buffer_object 1
+#define GL_QUERY_BUFFER_BARRIER_BIT 0x00008000
+#define GL_QUERY_BUFFER 0x9192
+#define GL_QUERY_RESULT_NO_WAIT 0x9194
+#define GLEW_ARB_query_buffer_object GLEW_GET_VAR(__GLEW_ARB_query_buffer_object)
+#endif /* GL_ARB_query_buffer_object */
+/* ------------------ GL_ARB_robust_buffer_access_behavior ----------------- */
+#ifndef GL_ARB_robust_buffer_access_behavior
+#define GL_ARB_robust_buffer_access_behavior 1
+#define GLEW_ARB_robust_buffer_access_behavior GLEW_GET_VAR(__GLEW_ARB_robust_buffer_access_behavior)
+#endif /* GL_ARB_robust_buffer_access_behavior */
+/* --------------------------- GL_ARB_robustness --------------------------- */
+#ifndef GL_ARB_robustness
+#define GL_ARB_robustness 1
+typedef void (GLAPIENTRY * PFNGLGETNCOLORTABLEARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void* table);
+typedef void (GLAPIENTRY * PFNGLGETNCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint lod, GLsizei bufSize, void* img);
+typedef void (GLAPIENTRY * PFNGLGETNCONVOLUTIONFILTERARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void* image);
+typedef void (GLAPIENTRY * PFNGLGETNHISTOGRAMARBPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void* values);
+typedef void (GLAPIENTRY * PFNGLGETNMAPDVARBPROC) (GLenum target, GLenum query, GLsizei bufSize, GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLGETNMAPFVARBPROC) (GLenum target, GLenum query, GLsizei bufSize, GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLGETNMAPIVARBPROC) (GLenum target, GLenum query, GLsizei bufSize, GLint* v);
+typedef void (GLAPIENTRY * PFNGLGETNMINMAXARBPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void* values);
+typedef void (GLAPIENTRY * PFNGLGETNPIXELMAPFVARBPROC) (GLenum map, GLsizei bufSize, GLfloat* values);
+typedef void (GLAPIENTRY * PFNGLGETNPIXELMAPUIVARBPROC) (GLenum map, GLsizei bufSize, GLuint* values);
+typedef void (GLAPIENTRY * PFNGLGETNPIXELMAPUSVARBPROC) (GLenum map, GLsizei bufSize, GLushort* values);
+typedef void (GLAPIENTRY * PFNGLGETNPOLYGONSTIPPLEARBPROC) (GLsizei bufSize, GLubyte* pattern);
+typedef void (GLAPIENTRY * PFNGLGETNSEPARABLEFILTERARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, void* row, GLsizei columnBufSize, void*column, void*span);
+typedef void (GLAPIENTRY * PFNGLGETNTEXIMAGEARBPROC) (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void* img);
+typedef void (GLAPIENTRY * PFNGLGETNUNIFORMDVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLGETNUNIFORMFVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETNUNIFORMIVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETNUNIFORMUIVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLREADNPIXELSARBPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void* data);
+#define glGetGraphicsResetStatusARB GLEW_GET_FUN(__glewGetGraphicsResetStatusARB)
+#define glGetnColorTableARB GLEW_GET_FUN(__glewGetnColorTableARB)
+#define glGetnCompressedTexImageARB GLEW_GET_FUN(__glewGetnCompressedTexImageARB)
+#define glGetnConvolutionFilterARB GLEW_GET_FUN(__glewGetnConvolutionFilterARB)
+#define glGetnHistogramARB GLEW_GET_FUN(__glewGetnHistogramARB)
+#define glGetnMapdvARB GLEW_GET_FUN(__glewGetnMapdvARB)
+#define glGetnMapfvARB GLEW_GET_FUN(__glewGetnMapfvARB)
+#define glGetnMapivARB GLEW_GET_FUN(__glewGetnMapivARB)
+#define glGetnMinmaxARB GLEW_GET_FUN(__glewGetnMinmaxARB)
+#define glGetnPixelMapfvARB GLEW_GET_FUN(__glewGetnPixelMapfvARB)
+#define glGetnPixelMapuivARB GLEW_GET_FUN(__glewGetnPixelMapuivARB)
+#define glGetnPixelMapusvARB GLEW_GET_FUN(__glewGetnPixelMapusvARB)
+#define glGetnPolygonStippleARB GLEW_GET_FUN(__glewGetnPolygonStippleARB)
+#define glGetnSeparableFilterARB GLEW_GET_FUN(__glewGetnSeparableFilterARB)
+#define glGetnTexImageARB GLEW_GET_FUN(__glewGetnTexImageARB)
+#define glGetnUniformdvARB GLEW_GET_FUN(__glewGetnUniformdvARB)
+#define glGetnUniformfvARB GLEW_GET_FUN(__glewGetnUniformfvARB)
+#define glGetnUniformivARB GLEW_GET_FUN(__glewGetnUniformivARB)
+#define glGetnUniformuivARB GLEW_GET_FUN(__glewGetnUniformuivARB)
+#define glReadnPixelsARB GLEW_GET_FUN(__glewReadnPixelsARB)
+#define GLEW_ARB_robustness GLEW_GET_VAR(__GLEW_ARB_robustness)
+#endif /* GL_ARB_robustness */
+/* ---------------- GL_ARB_robustness_application_isolation ---------------- */
+#ifndef GL_ARB_robustness_application_isolation
+#define GL_ARB_robustness_application_isolation 1
+#define GLEW_ARB_robustness_application_isolation GLEW_GET_VAR(__GLEW_ARB_robustness_application_isolation)
+#endif /* GL_ARB_robustness_application_isolation */
+/* ---------------- GL_ARB_robustness_share_group_isolation ---------------- */
+#ifndef GL_ARB_robustness_share_group_isolation
+#define GL_ARB_robustness_share_group_isolation 1
+#define GLEW_ARB_robustness_share_group_isolation GLEW_GET_VAR(__GLEW_ARB_robustness_share_group_isolation)
+#endif /* GL_ARB_robustness_share_group_isolation */
+/* ------------------------ GL_ARB_sample_locations ------------------------ */
+#ifndef GL_ARB_sample_locations
+#define GL_ARB_sample_locations 1
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERSAMPLELOCATIONSFVARBPROC) (GLenum target, GLuint start, GLsizei count, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERSAMPLELOCATIONSFVARBPROC) (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat* v);
+#define glFramebufferSampleLocationsfvARB GLEW_GET_FUN(__glewFramebufferSampleLocationsfvARB)
+#define glNamedFramebufferSampleLocationsfvARB GLEW_GET_FUN(__glewNamedFramebufferSampleLocationsfvARB)
+#define GLEW_ARB_sample_locations GLEW_GET_VAR(__GLEW_ARB_sample_locations)
+#endif /* GL_ARB_sample_locations */
+/* ------------------------- GL_ARB_sample_shading ------------------------- */
+#ifndef GL_ARB_sample_shading
+#define GL_ARB_sample_shading 1
+#define glMinSampleShadingARB GLEW_GET_FUN(__glewMinSampleShadingARB)
+#define GLEW_ARB_sample_shading GLEW_GET_VAR(__GLEW_ARB_sample_shading)
+#endif /* GL_ARB_sample_shading */
+/* ------------------------- GL_ARB_sampler_objects ------------------------ */
+#ifndef GL_ARB_sampler_objects
+#define GL_ARB_sampler_objects 1
+#define GL_SAMPLER_BINDING 0x8919
+typedef void (GLAPIENTRY * PFNGLBINDSAMPLERPROC) (GLuint unit, GLuint sampler);
+typedef void (GLAPIENTRY * PFNGLDELETESAMPLERSPROC) (GLsizei count, const GLuint * samplers);
+typedef void (GLAPIENTRY * PFNGLGENSAMPLERSPROC) (GLsizei count, GLuint* samplers);
+typedef void (GLAPIENTRY * PFNGLGETSAMPLERPARAMETERIIVPROC) (GLuint sampler, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETSAMPLERPARAMETERIUIVPROC) (GLuint sampler, GLenum pname, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETSAMPLERPARAMETERFVPROC) (GLuint sampler, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETSAMPLERPARAMETERIVPROC) (GLuint sampler, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISSAMPLERPROC) (GLuint sampler);
+typedef void (GLAPIENTRY * PFNGLSAMPLERPARAMETERIIVPROC) (GLuint sampler, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLSAMPLERPARAMETERIUIVPROC) (GLuint sampler, GLenum pname, const GLuint* params);
+typedef void (GLAPIENTRY * PFNGLSAMPLERPARAMETERFPROC) (GLuint sampler, GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLSAMPLERPARAMETERFVPROC) (GLuint sampler, GLenum pname, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLSAMPLERPARAMETERIPROC) (GLuint sampler, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLSAMPLERPARAMETERIVPROC) (GLuint sampler, GLenum pname, const GLint* params);
+#define glBindSampler GLEW_GET_FUN(__glewBindSampler)
+#define glDeleteSamplers GLEW_GET_FUN(__glewDeleteSamplers)
+#define glGenSamplers GLEW_GET_FUN(__glewGenSamplers)
+#define glGetSamplerParameterIiv GLEW_GET_FUN(__glewGetSamplerParameterIiv)
+#define glGetSamplerParameterIuiv GLEW_GET_FUN(__glewGetSamplerParameterIuiv)
+#define glGetSamplerParameterfv GLEW_GET_FUN(__glewGetSamplerParameterfv)
+#define glGetSamplerParameteriv GLEW_GET_FUN(__glewGetSamplerParameteriv)
+#define glIsSampler GLEW_GET_FUN(__glewIsSampler)
+#define glSamplerParameterIiv GLEW_GET_FUN(__glewSamplerParameterIiv)
+#define glSamplerParameterIuiv GLEW_GET_FUN(__glewSamplerParameterIuiv)
+#define glSamplerParameterf GLEW_GET_FUN(__glewSamplerParameterf)
+#define glSamplerParameterfv GLEW_GET_FUN(__glewSamplerParameterfv)
+#define glSamplerParameteri GLEW_GET_FUN(__glewSamplerParameteri)
+#define glSamplerParameteriv GLEW_GET_FUN(__glewSamplerParameteriv)
+#define GLEW_ARB_sampler_objects GLEW_GET_VAR(__GLEW_ARB_sampler_objects)
+#endif /* GL_ARB_sampler_objects */
+/* ------------------------ GL_ARB_seamless_cube_map ----------------------- */
+#ifndef GL_ARB_seamless_cube_map
+#define GL_ARB_seamless_cube_map 1
+#define GLEW_ARB_seamless_cube_map GLEW_GET_VAR(__GLEW_ARB_seamless_cube_map)
+#endif /* GL_ARB_seamless_cube_map */
+/* ------------------ GL_ARB_seamless_cubemap_per_texture ------------------ */
+#ifndef GL_ARB_seamless_cubemap_per_texture
+#define GL_ARB_seamless_cubemap_per_texture 1
+#define GLEW_ARB_seamless_cubemap_per_texture GLEW_GET_VAR(__GLEW_ARB_seamless_cubemap_per_texture)
+#endif /* GL_ARB_seamless_cubemap_per_texture */
+/* --------------------- GL_ARB_separate_shader_objects -------------------- */
+#ifndef GL_ARB_separate_shader_objects
+#define GL_ARB_separate_shader_objects 1
+#define GL_VERTEX_SHADER_BIT 0x00000001
+#define GL_FRAGMENT_SHADER_BIT 0x00000002
+#define GL_GEOMETRY_SHADER_BIT 0x00000004
+#define GL_TESS_CONTROL_SHADER_BIT 0x00000008
+#define GL_PROGRAM_SEPARABLE 0x8258
+#define GL_ACTIVE_PROGRAM 0x8259
+typedef void (GLAPIENTRY * PFNGLACTIVESHADERPROGRAMPROC) (GLuint pipeline, GLuint program);
+typedef GLuint (GLAPIENTRY * PFNGLCREATESHADERPROGRAMVPROC) (GLenum type, GLsizei count, const GLchar * const * strings);
+typedef void (GLAPIENTRY * PFNGLDELETEPROGRAMPIPELINESPROC) (GLsizei n, const GLuint* pipelines);
+typedef void (GLAPIENTRY * PFNGLGENPROGRAMPIPELINESPROC) (GLsizei n, GLuint* pipelines);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMPIPELINEINFOLOGPROC) (GLuint pipeline, GLsizei bufSize, GLsizei* length, GLchar *infoLog);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMPIPELINEIVPROC) (GLuint pipeline, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1DPROC) (GLuint program, GLint location, GLdouble x);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1FPROC) (GLuint program, GLint location, GLfloat x);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1IPROC) (GLuint program, GLint location, GLint x);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1IVPROC) (GLuint program, GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1UIPROC) (GLuint program, GLint location, GLuint x);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2DPROC) (GLuint program, GLint location, GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2FPROC) (GLuint program, GLint location, GLfloat x, GLfloat y);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2IPROC) (GLuint program, GLint location, GLint x, GLint y);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2IVPROC) (GLuint program, GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2UIPROC) (GLuint program, GLint location, GLuint x, GLuint y);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3DPROC) (GLuint program, GLint location, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3FPROC) (GLuint program, GLint location, GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3IPROC) (GLuint program, GLint location, GLint x, GLint y, GLint z);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3IVPROC) (GLuint program, GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3UIPROC) (GLuint program, GLint location, GLuint x, GLuint y, GLuint z);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4DPROC) (GLuint program, GLint location, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4FPROC) (GLuint program, GLint location, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4IPROC) (GLuint program, GLint location, GLint x, GLint y, GLint z, GLint w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4IVPROC) (GLuint program, GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4UIPROC) (GLuint program, GLint location, GLuint x, GLuint y, GLuint z, GLuint w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX2DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX2FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX2X3DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX2X3FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX2X4DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX2X4FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX3DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX3FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX3X2DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX3X2FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX3X4DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX3X4FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX4DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX4FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX4X2DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX4X2FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX4X3DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX4X3FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUSEPROGRAMSTAGESPROC) (GLuint pipeline, GLbitfield stages, GLuint program);
+#define glActiveShaderProgram GLEW_GET_FUN(__glewActiveShaderProgram)
+#define glBindProgramPipeline GLEW_GET_FUN(__glewBindProgramPipeline)
+#define glCreateShaderProgramv GLEW_GET_FUN(__glewCreateShaderProgramv)
+#define glDeleteProgramPipelines GLEW_GET_FUN(__glewDeleteProgramPipelines)
+#define glGenProgramPipelines GLEW_GET_FUN(__glewGenProgramPipelines)
+#define glGetProgramPipelineInfoLog GLEW_GET_FUN(__glewGetProgramPipelineInfoLog)
+#define glGetProgramPipelineiv GLEW_GET_FUN(__glewGetProgramPipelineiv)
+#define glIsProgramPipeline GLEW_GET_FUN(__glewIsProgramPipeline)
+#define glProgramUniform1d GLEW_GET_FUN(__glewProgramUniform1d)
+#define glProgramUniform1dv GLEW_GET_FUN(__glewProgramUniform1dv)
+#define glProgramUniform1f GLEW_GET_FUN(__glewProgramUniform1f)
+#define glProgramUniform1fv GLEW_GET_FUN(__glewProgramUniform1fv)
+#define glProgramUniform1i GLEW_GET_FUN(__glewProgramUniform1i)
+#define glProgramUniform1iv GLEW_GET_FUN(__glewProgramUniform1iv)
+#define glProgramUniform1ui GLEW_GET_FUN(__glewProgramUniform1ui)
+#define glProgramUniform1uiv GLEW_GET_FUN(__glewProgramUniform1uiv)
+#define glProgramUniform2d GLEW_GET_FUN(__glewProgramUniform2d)
+#define glProgramUniform2dv GLEW_GET_FUN(__glewProgramUniform2dv)
+#define glProgramUniform2f GLEW_GET_FUN(__glewProgramUniform2f)
+#define glProgramUniform2fv GLEW_GET_FUN(__glewProgramUniform2fv)
+#define glProgramUniform2i GLEW_GET_FUN(__glewProgramUniform2i)
+#define glProgramUniform2iv GLEW_GET_FUN(__glewProgramUniform2iv)
+#define glProgramUniform2ui GLEW_GET_FUN(__glewProgramUniform2ui)
+#define glProgramUniform2uiv GLEW_GET_FUN(__glewProgramUniform2uiv)
+#define glProgramUniform3d GLEW_GET_FUN(__glewProgramUniform3d)
+#define glProgramUniform3dv GLEW_GET_FUN(__glewProgramUniform3dv)
+#define glProgramUniform3f GLEW_GET_FUN(__glewProgramUniform3f)
+#define glProgramUniform3fv GLEW_GET_FUN(__glewProgramUniform3fv)
+#define glProgramUniform3i GLEW_GET_FUN(__glewProgramUniform3i)
+#define glProgramUniform3iv GLEW_GET_FUN(__glewProgramUniform3iv)
+#define glProgramUniform3ui GLEW_GET_FUN(__glewProgramUniform3ui)
+#define glProgramUniform3uiv GLEW_GET_FUN(__glewProgramUniform3uiv)
+#define glProgramUniform4d GLEW_GET_FUN(__glewProgramUniform4d)
+#define glProgramUniform4dv GLEW_GET_FUN(__glewProgramUniform4dv)
+#define glProgramUniform4f GLEW_GET_FUN(__glewProgramUniform4f)
+#define glProgramUniform4fv GLEW_GET_FUN(__glewProgramUniform4fv)
+#define glProgramUniform4i GLEW_GET_FUN(__glewProgramUniform4i)
+#define glProgramUniform4iv GLEW_GET_FUN(__glewProgramUniform4iv)
+#define glProgramUniform4ui GLEW_GET_FUN(__glewProgramUniform4ui)
+#define glProgramUniform4uiv GLEW_GET_FUN(__glewProgramUniform4uiv)
+#define glProgramUniformMatrix2dv GLEW_GET_FUN(__glewProgramUniformMatrix2dv)
+#define glProgramUniformMatrix2fv GLEW_GET_FUN(__glewProgramUniformMatrix2fv)
+#define glProgramUniformMatrix2x3dv GLEW_GET_FUN(__glewProgramUniformMatrix2x3dv)
+#define glProgramUniformMatrix2x3fv GLEW_GET_FUN(__glewProgramUniformMatrix2x3fv)
+#define glProgramUniformMatrix2x4dv GLEW_GET_FUN(__glewProgramUniformMatrix2x4dv)
+#define glProgramUniformMatrix2x4fv GLEW_GET_FUN(__glewProgramUniformMatrix2x4fv)
+#define glProgramUniformMatrix3dv GLEW_GET_FUN(__glewProgramUniformMatrix3dv)
+#define glProgramUniformMatrix3fv GLEW_GET_FUN(__glewProgramUniformMatrix3fv)
+#define glProgramUniformMatrix3x2dv GLEW_GET_FUN(__glewProgramUniformMatrix3x2dv)
+#define glProgramUniformMatrix3x2fv GLEW_GET_FUN(__glewProgramUniformMatrix3x2fv)
+#define glProgramUniformMatrix3x4dv GLEW_GET_FUN(__glewProgramUniformMatrix3x4dv)
+#define glProgramUniformMatrix3x4fv GLEW_GET_FUN(__glewProgramUniformMatrix3x4fv)
+#define glProgramUniformMatrix4dv GLEW_GET_FUN(__glewProgramUniformMatrix4dv)
+#define glProgramUniformMatrix4fv GLEW_GET_FUN(__glewProgramUniformMatrix4fv)
+#define glProgramUniformMatrix4x2dv GLEW_GET_FUN(__glewProgramUniformMatrix4x2dv)
+#define glProgramUniformMatrix4x2fv GLEW_GET_FUN(__glewProgramUniformMatrix4x2fv)
+#define glProgramUniformMatrix4x3dv GLEW_GET_FUN(__glewProgramUniformMatrix4x3dv)
+#define glProgramUniformMatrix4x3fv GLEW_GET_FUN(__glewProgramUniformMatrix4x3fv)
+#define glUseProgramStages GLEW_GET_FUN(__glewUseProgramStages)
+#define glValidateProgramPipeline GLEW_GET_FUN(__glewValidateProgramPipeline)
+#define GLEW_ARB_separate_shader_objects GLEW_GET_VAR(__GLEW_ARB_separate_shader_objects)
+#endif /* GL_ARB_separate_shader_objects */
+/* -------------------- GL_ARB_shader_atomic_counter_ops ------------------- */
+#ifndef GL_ARB_shader_atomic_counter_ops
+#define GL_ARB_shader_atomic_counter_ops 1
+#define GLEW_ARB_shader_atomic_counter_ops GLEW_GET_VAR(__GLEW_ARB_shader_atomic_counter_ops)
+#endif /* GL_ARB_shader_atomic_counter_ops */
+/* --------------------- GL_ARB_shader_atomic_counters --------------------- */
+#ifndef GL_ARB_shader_atomic_counters
+#define GL_ARB_shader_atomic_counters 1
+typedef void (GLAPIENTRY * PFNGLGETACTIVEATOMICCOUNTERBUFFERIVPROC) (GLuint program, GLuint bufferIndex, GLenum pname, GLint* params);
+#define glGetActiveAtomicCounterBufferiv GLEW_GET_FUN(__glewGetActiveAtomicCounterBufferiv)
+#define GLEW_ARB_shader_atomic_counters GLEW_GET_VAR(__GLEW_ARB_shader_atomic_counters)
+#endif /* GL_ARB_shader_atomic_counters */
+/* -------------------------- GL_ARB_shader_ballot ------------------------- */
+#ifndef GL_ARB_shader_ballot
+#define GL_ARB_shader_ballot 1
+#define GLEW_ARB_shader_ballot GLEW_GET_VAR(__GLEW_ARB_shader_ballot)
+#endif /* GL_ARB_shader_ballot */
+/* ----------------------- GL_ARB_shader_bit_encoding ---------------------- */
+#ifndef GL_ARB_shader_bit_encoding
+#define GL_ARB_shader_bit_encoding 1
+#define GLEW_ARB_shader_bit_encoding GLEW_GET_VAR(__GLEW_ARB_shader_bit_encoding)
+#endif /* GL_ARB_shader_bit_encoding */
+/* -------------------------- GL_ARB_shader_clock -------------------------- */
+#ifndef GL_ARB_shader_clock
+#define GL_ARB_shader_clock 1
+#define GLEW_ARB_shader_clock GLEW_GET_VAR(__GLEW_ARB_shader_clock)
+#endif /* GL_ARB_shader_clock */
+/* --------------------- GL_ARB_shader_draw_parameters --------------------- */
+#ifndef GL_ARB_shader_draw_parameters
+#define GL_ARB_shader_draw_parameters 1
+#define GLEW_ARB_shader_draw_parameters GLEW_GET_VAR(__GLEW_ARB_shader_draw_parameters)
+#endif /* GL_ARB_shader_draw_parameters */
+/* ------------------------ GL_ARB_shader_group_vote ----------------------- */
+#ifndef GL_ARB_shader_group_vote
+#define GL_ARB_shader_group_vote 1
+#define GLEW_ARB_shader_group_vote GLEW_GET_VAR(__GLEW_ARB_shader_group_vote)
+#endif /* GL_ARB_shader_group_vote */
+/* --------------------- GL_ARB_shader_image_load_store -------------------- */
+#ifndef GL_ARB_shader_image_load_store
+#define GL_ARB_shader_image_load_store 1
+#define GL_ELEMENT_ARRAY_BARRIER_BIT 0x00000002
+#define GL_UNIFORM_BARRIER_BIT 0x00000004
+#define GL_TEXTURE_FETCH_BARRIER_BIT 0x00000008
+#define GL_COMMAND_BARRIER_BIT 0x00000040
+#define GL_PIXEL_BUFFER_BARRIER_BIT 0x00000080
+#define GL_BUFFER_UPDATE_BARRIER_BIT 0x00000200
+#define GL_FRAMEBUFFER_BARRIER_BIT 0x00000400
+#define GL_MAX_IMAGE_UNITS 0x8F38
+#define GL_IMAGE_1D 0x904C
+#define GL_IMAGE_2D 0x904D
+#define GL_IMAGE_3D 0x904E
+#define GL_IMAGE_2D_RECT 0x904F
+#define GL_IMAGE_CUBE 0x9050
+#define GL_IMAGE_BUFFER 0x9051
+#define GL_IMAGE_1D_ARRAY 0x9052
+#define GL_IMAGE_2D_ARRAY 0x9053
+#define GL_IMAGE_CUBE_MAP_ARRAY 0x9054
+#define GL_IMAGE_2D_MULTISAMPLE 0x9055
+#define GL_INT_IMAGE_1D 0x9057
+#define GL_INT_IMAGE_2D 0x9058
+#define GL_INT_IMAGE_3D 0x9059
+#define GL_INT_IMAGE_2D_RECT 0x905A
+#define GL_INT_IMAGE_CUBE 0x905B
+#define GL_INT_IMAGE_BUFFER 0x905C
+#define GL_INT_IMAGE_1D_ARRAY 0x905D
+#define GL_INT_IMAGE_2D_ARRAY 0x905E
+#define GL_UNSIGNED_INT_IMAGE_1D 0x9062
+#define GL_UNSIGNED_INT_IMAGE_2D 0x9063
+#define GL_UNSIGNED_INT_IMAGE_3D 0x9064
+#define GL_MAX_IMAGE_SAMPLES 0x906D
+typedef void (GLAPIENTRY * PFNGLBINDIMAGETEXTUREPROC) (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format);
+typedef void (GLAPIENTRY * PFNGLMEMORYBARRIERPROC) (GLbitfield barriers);
+#define glBindImageTexture GLEW_GET_FUN(__glewBindImageTexture)
+#define glMemoryBarrier GLEW_GET_FUN(__glewMemoryBarrier)
+#define GLEW_ARB_shader_image_load_store GLEW_GET_VAR(__GLEW_ARB_shader_image_load_store)
+#endif /* GL_ARB_shader_image_load_store */
+/* ------------------------ GL_ARB_shader_image_size ----------------------- */
+#ifndef GL_ARB_shader_image_size
+#define GL_ARB_shader_image_size 1
+#define GLEW_ARB_shader_image_size GLEW_GET_VAR(__GLEW_ARB_shader_image_size)
+#endif /* GL_ARB_shader_image_size */
+/* ------------------------- GL_ARB_shader_objects ------------------------- */
+#ifndef GL_ARB_shader_objects
+#define GL_ARB_shader_objects 1
+#define GL_SHADER_OBJECT_ARB 0x8B48
+#define GL_OBJECT_TYPE_ARB 0x8B4E
+#define GL_FLOAT_VEC2_ARB 0x8B50
+#define GL_FLOAT_VEC3_ARB 0x8B51
+#define GL_FLOAT_VEC4_ARB 0x8B52
+#define GL_INT_VEC2_ARB 0x8B53
+#define GL_INT_VEC3_ARB 0x8B54
+#define GL_INT_VEC4_ARB 0x8B55
+#define GL_BOOL_ARB 0x8B56
+#define GL_BOOL_VEC2_ARB 0x8B57
+#define GL_BOOL_VEC3_ARB 0x8B58
+#define GL_BOOL_VEC4_ARB 0x8B59
+#define GL_FLOAT_MAT2_ARB 0x8B5A
+#define GL_FLOAT_MAT3_ARB 0x8B5B
+#define GL_FLOAT_MAT4_ARB 0x8B5C
+#define GL_SAMPLER_1D_ARB 0x8B5D
+#define GL_SAMPLER_2D_ARB 0x8B5E
+#define GL_SAMPLER_3D_ARB 0x8B5F
+#define GL_SAMPLER_CUBE_ARB 0x8B60
+#define GL_SAMPLER_1D_SHADOW_ARB 0x8B61
+#define GL_SAMPLER_2D_SHADOW_ARB 0x8B62
+#define GL_SAMPLER_2D_RECT_ARB 0x8B63
+typedef char GLcharARB;
+typedef unsigned int GLhandleARB;
+typedef void (GLAPIENTRY * PFNGLATTACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB obj);
+typedef void (GLAPIENTRY * PFNGLDETACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB attachedObj);
+typedef void (GLAPIENTRY * PFNGLGETACTIVEUNIFORMARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei* length, GLint *size, GLenum *type, GLcharARB *name);
+typedef void (GLAPIENTRY * PFNGLGETATTACHEDOBJECTSARBPROC) (GLhandleARB containerObj, GLsizei maxCount, GLsizei* count, GLhandleARB *obj);
+typedef void (GLAPIENTRY * PFNGLGETINFOLOGARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei* length, GLcharARB *infoLog);
+typedef void (GLAPIENTRY * PFNGLGETOBJECTPARAMETERFVARBPROC) (GLhandleARB obj, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETOBJECTPARAMETERIVARBPROC) (GLhandleARB obj, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETSHADERSOURCEARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei* length, GLcharARB *source);
+typedef GLint (GLAPIENTRY * PFNGLGETUNIFORMLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB* name);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMFVARBPROC) (GLhandleARB programObj, GLint location, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMIVARBPROC) (GLhandleARB programObj, GLint location, GLint* params);
+typedef void (GLAPIENTRY * PFNGLLINKPROGRAMARBPROC) (GLhandleARB programObj);
+typedef void (GLAPIENTRY * PFNGLSHADERSOURCEARBPROC) (GLhandleARB shaderObj, GLsizei count, const GLcharARB ** string, const GLint *length);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1FARBPROC) (GLint location, GLfloat v0);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1FVARBPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1IARBPROC) (GLint location, GLint v0);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1IVARBPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2FARBPROC) (GLint location, GLfloat v0, GLfloat v1);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2FVARBPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2IARBPROC) (GLint location, GLint v0, GLint v1);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2IVARBPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3FVARBPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3IVARBPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4FVARBPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4IVARBPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+#define glAttachObjectARB GLEW_GET_FUN(__glewAttachObjectARB)
+#define glCompileShaderARB GLEW_GET_FUN(__glewCompileShaderARB)
+#define glCreateProgramObjectARB GLEW_GET_FUN(__glewCreateProgramObjectARB)
+#define glCreateShaderObjectARB GLEW_GET_FUN(__glewCreateShaderObjectARB)
+#define glDeleteObjectARB GLEW_GET_FUN(__glewDeleteObjectARB)
+#define glDetachObjectARB GLEW_GET_FUN(__glewDetachObjectARB)
+#define glGetActiveUniformARB GLEW_GET_FUN(__glewGetActiveUniformARB)
+#define glGetAttachedObjectsARB GLEW_GET_FUN(__glewGetAttachedObjectsARB)
+#define glGetHandleARB GLEW_GET_FUN(__glewGetHandleARB)
+#define glGetInfoLogARB GLEW_GET_FUN(__glewGetInfoLogARB)
+#define glGetObjectParameterfvARB GLEW_GET_FUN(__glewGetObjectParameterfvARB)
+#define glGetObjectParameterivARB GLEW_GET_FUN(__glewGetObjectParameterivARB)
+#define glGetShaderSourceARB GLEW_GET_FUN(__glewGetShaderSourceARB)
+#define glGetUniformLocationARB GLEW_GET_FUN(__glewGetUniformLocationARB)
+#define glGetUniformfvARB GLEW_GET_FUN(__glewGetUniformfvARB)
+#define glGetUniformivARB GLEW_GET_FUN(__glewGetUniformivARB)
+#define glLinkProgramARB GLEW_GET_FUN(__glewLinkProgramARB)
+#define glShaderSourceARB GLEW_GET_FUN(__glewShaderSourceARB)
+#define glUniform1fARB GLEW_GET_FUN(__glewUniform1fARB)
+#define glUniform1fvARB GLEW_GET_FUN(__glewUniform1fvARB)
+#define glUniform1iARB GLEW_GET_FUN(__glewUniform1iARB)
+#define glUniform1ivARB GLEW_GET_FUN(__glewUniform1ivARB)
+#define glUniform2fARB GLEW_GET_FUN(__glewUniform2fARB)
+#define glUniform2fvARB GLEW_GET_FUN(__glewUniform2fvARB)
+#define glUniform2iARB GLEW_GET_FUN(__glewUniform2iARB)
+#define glUniform2ivARB GLEW_GET_FUN(__glewUniform2ivARB)
+#define glUniform3fARB GLEW_GET_FUN(__glewUniform3fARB)
+#define glUniform3fvARB GLEW_GET_FUN(__glewUniform3fvARB)
+#define glUniform3iARB GLEW_GET_FUN(__glewUniform3iARB)
+#define glUniform3ivARB GLEW_GET_FUN(__glewUniform3ivARB)
+#define glUniform4fARB GLEW_GET_FUN(__glewUniform4fARB)
+#define glUniform4fvARB GLEW_GET_FUN(__glewUniform4fvARB)
+#define glUniform4iARB GLEW_GET_FUN(__glewUniform4iARB)
+#define glUniform4ivARB GLEW_GET_FUN(__glewUniform4ivARB)
+#define glUniformMatrix2fvARB GLEW_GET_FUN(__glewUniformMatrix2fvARB)
+#define glUniformMatrix3fvARB GLEW_GET_FUN(__glewUniformMatrix3fvARB)
+#define glUniformMatrix4fvARB GLEW_GET_FUN(__glewUniformMatrix4fvARB)
+#define glUseProgramObjectARB GLEW_GET_FUN(__glewUseProgramObjectARB)
+#define glValidateProgramARB GLEW_GET_FUN(__glewValidateProgramARB)
+#define GLEW_ARB_shader_objects GLEW_GET_VAR(__GLEW_ARB_shader_objects)
+#endif /* GL_ARB_shader_objects */
+/* ------------------------ GL_ARB_shader_precision ------------------------ */
+#ifndef GL_ARB_shader_precision
+#define GL_ARB_shader_precision 1
+#define GLEW_ARB_shader_precision GLEW_GET_VAR(__GLEW_ARB_shader_precision)
+#endif /* GL_ARB_shader_precision */
+/* ---------------------- GL_ARB_shader_stencil_export --------------------- */
+#ifndef GL_ARB_shader_stencil_export
+#define GL_ARB_shader_stencil_export 1
+#define GLEW_ARB_shader_stencil_export GLEW_GET_VAR(__GLEW_ARB_shader_stencil_export)
+#endif /* GL_ARB_shader_stencil_export */
+/* ------------------ GL_ARB_shader_storage_buffer_object ------------------ */
+#ifndef GL_ARB_shader_storage_buffer_object
+#define GL_ARB_shader_storage_buffer_object 1
+typedef void (GLAPIENTRY * PFNGLSHADERSTORAGEBLOCKBINDINGPROC) (GLuint program, GLuint storageBlockIndex, GLuint storageBlockBinding);
+#define glShaderStorageBlockBinding GLEW_GET_FUN(__glewShaderStorageBlockBinding)
+#define GLEW_ARB_shader_storage_buffer_object GLEW_GET_VAR(__GLEW_ARB_shader_storage_buffer_object)
+#endif /* GL_ARB_shader_storage_buffer_object */
+/* ------------------------ GL_ARB_shader_subroutine ----------------------- */
+#ifndef GL_ARB_shader_subroutine
+#define GL_ARB_shader_subroutine 1
+typedef void (GLAPIENTRY * PFNGLGETACTIVESUBROUTINENAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei* length, GLchar *name);
+typedef void (GLAPIENTRY * PFNGLGETACTIVESUBROUTINEUNIFORMNAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei* length, GLchar *name);
+typedef void (GLAPIENTRY * PFNGLGETACTIVESUBROUTINEUNIFORMIVPROC) (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint* values);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMSTAGEIVPROC) (GLuint program, GLenum shadertype, GLenum pname, GLint* values);
+typedef GLuint (GLAPIENTRY * PFNGLGETSUBROUTINEINDEXPROC) (GLuint program, GLenum shadertype, const GLchar* name);
+typedef GLint (GLAPIENTRY * PFNGLGETSUBROUTINEUNIFORMLOCATIONPROC) (GLuint program, GLenum shadertype, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMSUBROUTINEUIVPROC) (GLenum shadertype, GLint location, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLUNIFORMSUBROUTINESUIVPROC) (GLenum shadertype, GLsizei count, const GLuint* indices);
+#define glGetActiveSubroutineName GLEW_GET_FUN(__glewGetActiveSubroutineName)
+#define glGetActiveSubroutineUniformName GLEW_GET_FUN(__glewGetActiveSubroutineUniformName)
+#define glGetActiveSubroutineUniformiv GLEW_GET_FUN(__glewGetActiveSubroutineUniformiv)
+#define glGetProgramStageiv GLEW_GET_FUN(__glewGetProgramStageiv)
+#define glGetSubroutineIndex GLEW_GET_FUN(__glewGetSubroutineIndex)
+#define glGetSubroutineUniformLocation GLEW_GET_FUN(__glewGetSubroutineUniformLocation)
+#define glGetUniformSubroutineuiv GLEW_GET_FUN(__glewGetUniformSubroutineuiv)
+#define glUniformSubroutinesuiv GLEW_GET_FUN(__glewUniformSubroutinesuiv)
+#define GLEW_ARB_shader_subroutine GLEW_GET_VAR(__GLEW_ARB_shader_subroutine)
+#endif /* GL_ARB_shader_subroutine */
+/* ------------------ GL_ARB_shader_texture_image_samples ------------------ */
+#ifndef GL_ARB_shader_texture_image_samples
+#define GL_ARB_shader_texture_image_samples 1
+#define GLEW_ARB_shader_texture_image_samples GLEW_GET_VAR(__GLEW_ARB_shader_texture_image_samples)
+#endif /* GL_ARB_shader_texture_image_samples */
+/* ----------------------- GL_ARB_shader_texture_lod ----------------------- */
+#ifndef GL_ARB_shader_texture_lod
+#define GL_ARB_shader_texture_lod 1
+#define GLEW_ARB_shader_texture_lod GLEW_GET_VAR(__GLEW_ARB_shader_texture_lod)
+#endif /* GL_ARB_shader_texture_lod */
+/* ------------------- GL_ARB_shader_viewport_layer_array ------------------ */
+#ifndef GL_ARB_shader_viewport_layer_array
+#define GL_ARB_shader_viewport_layer_array 1
+#define GLEW_ARB_shader_viewport_layer_array GLEW_GET_VAR(__GLEW_ARB_shader_viewport_layer_array)
+#endif /* GL_ARB_shader_viewport_layer_array */
+/* ---------------------- GL_ARB_shading_language_100 ---------------------- */
+#ifndef GL_ARB_shading_language_100
+#define GL_ARB_shading_language_100 1
+#define GLEW_ARB_shading_language_100 GLEW_GET_VAR(__GLEW_ARB_shading_language_100)
+#endif /* GL_ARB_shading_language_100 */
+/* -------------------- GL_ARB_shading_language_420pack -------------------- */
+#ifndef GL_ARB_shading_language_420pack
+#define GL_ARB_shading_language_420pack 1
+#define GLEW_ARB_shading_language_420pack GLEW_GET_VAR(__GLEW_ARB_shading_language_420pack)
+#endif /* GL_ARB_shading_language_420pack */
+/* -------------------- GL_ARB_shading_language_include -------------------- */
+#ifndef GL_ARB_shading_language_include
+#define GL_ARB_shading_language_include 1
+typedef void (GLAPIENTRY * PFNGLCOMPILESHADERINCLUDEARBPROC) (GLuint shader, GLsizei count, const GLchar* const *path, const GLint *length);
+typedef void (GLAPIENTRY * PFNGLDELETENAMEDSTRINGARBPROC) (GLint namelen, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDSTRINGARBPROC) (GLint namelen, const GLchar* name, GLsizei bufSize, GLint *stringlen, GLchar *string);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDSTRINGIVARBPROC) (GLint namelen, const GLchar* name, GLenum pname, GLint *params);
+typedef GLboolean (GLAPIENTRY * PFNGLISNAMEDSTRINGARBPROC) (GLint namelen, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLNAMEDSTRINGARBPROC) (GLenum type, GLint namelen, const GLchar* name, GLint stringlen, const GLchar *string);
+#define glCompileShaderIncludeARB GLEW_GET_FUN(__glewCompileShaderIncludeARB)
+#define glDeleteNamedStringARB GLEW_GET_FUN(__glewDeleteNamedStringARB)
+#define glGetNamedStringARB GLEW_GET_FUN(__glewGetNamedStringARB)
+#define glGetNamedStringivARB GLEW_GET_FUN(__glewGetNamedStringivARB)
+#define glIsNamedStringARB GLEW_GET_FUN(__glewIsNamedStringARB)
+#define glNamedStringARB GLEW_GET_FUN(__glewNamedStringARB)
+#define GLEW_ARB_shading_language_include GLEW_GET_VAR(__GLEW_ARB_shading_language_include)
+#endif /* GL_ARB_shading_language_include */
+/* -------------------- GL_ARB_shading_language_packing -------------------- */
+#ifndef GL_ARB_shading_language_packing
+#define GL_ARB_shading_language_packing 1
+#define GLEW_ARB_shading_language_packing GLEW_GET_VAR(__GLEW_ARB_shading_language_packing)
+#endif /* GL_ARB_shading_language_packing */
+/* ----------------------------- GL_ARB_shadow ----------------------------- */
+#ifndef GL_ARB_shadow
+#define GL_ARB_shadow 1
+#define GLEW_ARB_shadow GLEW_GET_VAR(__GLEW_ARB_shadow)
+#endif /* GL_ARB_shadow */
+/* ------------------------- GL_ARB_shadow_ambient ------------------------- */
+#ifndef GL_ARB_shadow_ambient
+#define GL_ARB_shadow_ambient 1
+#define GLEW_ARB_shadow_ambient GLEW_GET_VAR(__GLEW_ARB_shadow_ambient)
+#endif /* GL_ARB_shadow_ambient */
+/* -------------------------- GL_ARB_sparse_buffer ------------------------- */
+#ifndef GL_ARB_sparse_buffer
+#define GL_ARB_sparse_buffer 1
+typedef void (GLAPIENTRY * PFNGLBUFFERPAGECOMMITMENTARBPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLboolean commit);
+#define glBufferPageCommitmentARB GLEW_GET_FUN(__glewBufferPageCommitmentARB)
+#define GLEW_ARB_sparse_buffer GLEW_GET_VAR(__GLEW_ARB_sparse_buffer)
+#endif /* GL_ARB_sparse_buffer */
+/* ------------------------- GL_ARB_sparse_texture ------------------------- */
+#ifndef GL_ARB_sparse_texture
+#define GL_ARB_sparse_texture 1
+#define GL_VIRTUAL_PAGE_SIZE_X_ARB 0x9195
+#define GL_VIRTUAL_PAGE_SIZE_Y_ARB 0x9196
+#define GL_VIRTUAL_PAGE_SIZE_Z_ARB 0x9197
+typedef void (GLAPIENTRY * PFNGLTEXPAGECOMMITMENTARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit);
+#define glTexPageCommitmentARB GLEW_GET_FUN(__glewTexPageCommitmentARB)
+#define GLEW_ARB_sparse_texture GLEW_GET_VAR(__GLEW_ARB_sparse_texture)
+#endif /* GL_ARB_sparse_texture */
+/* ------------------------- GL_ARB_sparse_texture2 ------------------------ */
+#ifndef GL_ARB_sparse_texture2
+#define GL_ARB_sparse_texture2 1
+#define GLEW_ARB_sparse_texture2 GLEW_GET_VAR(__GLEW_ARB_sparse_texture2)
+#endif /* GL_ARB_sparse_texture2 */
+/* ---------------------- GL_ARB_sparse_texture_clamp ---------------------- */
+#ifndef GL_ARB_sparse_texture_clamp
+#define GL_ARB_sparse_texture_clamp 1
+#define GLEW_ARB_sparse_texture_clamp GLEW_GET_VAR(__GLEW_ARB_sparse_texture_clamp)
+#endif /* GL_ARB_sparse_texture_clamp */
+/* ------------------------ GL_ARB_spirv_extensions ------------------------ */
+#ifndef GL_ARB_spirv_extensions
+#define GL_ARB_spirv_extensions 1
+#define GL_SPIR_V_EXTENSIONS 0x9553
+#define GL_NUM_SPIR_V_EXTENSIONS 0x9554
+#define GLEW_ARB_spirv_extensions GLEW_GET_VAR(__GLEW_ARB_spirv_extensions)
+#endif /* GL_ARB_spirv_extensions */
+/* ------------------------ GL_ARB_stencil_texturing ----------------------- */
+#ifndef GL_ARB_stencil_texturing
+#define GL_ARB_stencil_texturing 1
+#define GLEW_ARB_stencil_texturing GLEW_GET_VAR(__GLEW_ARB_stencil_texturing)
+#endif /* GL_ARB_stencil_texturing */
+/* ------------------------------ GL_ARB_sync ------------------------------ */
+#ifndef GL_ARB_sync
+#define GL_ARB_sync 1
+#define GL_SYNC_FLUSH_COMMANDS_BIT 0x00000001
+#define GL_OBJECT_TYPE 0x9112
+#define GL_SYNC_CONDITION 0x9113
+#define GL_SYNC_STATUS 0x9114
+#define GL_SYNC_FLAGS 0x9115
+#define GL_SYNC_FENCE 0x9116
+#define GL_UNSIGNALED 0x9118
+#define GL_SIGNALED 0x9119
+#define GL_TIMEOUT_EXPIRED 0x911B
+#define GL_WAIT_FAILED 0x911D
+typedef GLenum (GLAPIENTRY * PFNGLCLIENTWAITSYNCPROC) (GLsync GLsync,GLbitfield flags,GLuint64 timeout);
+typedef GLsync (GLAPIENTRY * PFNGLFENCESYNCPROC) (GLenum condition,GLbitfield flags);
+typedef void (GLAPIENTRY * PFNGLGETINTEGER64VPROC) (GLenum pname, GLint64* params);
+typedef void (GLAPIENTRY * PFNGLGETSYNCIVPROC) (GLsync GLsync,GLenum pname,GLsizei bufSize,GLsizei* length, GLint *values);
+typedef GLboolean (GLAPIENTRY * PFNGLISSYNCPROC) (GLsync GLsync);
+typedef void (GLAPIENTRY * PFNGLWAITSYNCPROC) (GLsync GLsync,GLbitfield flags,GLuint64 timeout);
+#define glClientWaitSync GLEW_GET_FUN(__glewClientWaitSync)
+#define glDeleteSync GLEW_GET_FUN(__glewDeleteSync)
+#define glFenceSync GLEW_GET_FUN(__glewFenceSync)
+#define glGetInteger64v GLEW_GET_FUN(__glewGetInteger64v)
+#define glGetSynciv GLEW_GET_FUN(__glewGetSynciv)
+#define glIsSync GLEW_GET_FUN(__glewIsSync)
+#define glWaitSync GLEW_GET_FUN(__glewWaitSync)
+#define GLEW_ARB_sync GLEW_GET_VAR(__GLEW_ARB_sync)
+#endif /* GL_ARB_sync */
+/* ----------------------- GL_ARB_tessellation_shader ---------------------- */
+#ifndef GL_ARB_tessellation_shader
+#define GL_ARB_tessellation_shader 1
+#define GL_PATCHES 0xE
+#define GL_PATCH_VERTICES 0x8E72
+#define GL_TESS_GEN_MODE 0x8E76
+#define GL_TESS_GEN_SPACING 0x8E77
+#define GL_TESS_GEN_POINT_MODE 0x8E79
+#define GL_ISOLINES 0x8E7A