diff options
-rw-r--r--canvas.lv2/canvas.lv2/canvas.h (renamed from canvas.lv2/canvas.h)0
-rw-r--r--canvas.lv2/canvas.lv2/forge.h (renamed from canvas.lv2/forge.h)0
-rw-r--r--canvas.lv2/canvas.lv2/render.h (renamed from canvas.lv2/render.h)0
-rw-r--r--canvas.lv2/canvas.lv2/render_cairo.h (renamed from canvas.lv2/render_cairo.h)0
-rw-r--r--canvas.lv2/canvas.lv2/render_nanovg.h (renamed from canvas.lv2/render_nanovg.h)0
-rw-r--r--nanovg/example/NotoEmoji-Regular.ttfbin0 -> 418804 bytes
-rwxr-xr-xnanovg/example/Roboto-Bold.ttfbin0 -> 135820 bytes
-rwxr-xr-xnanovg/example/Roboto-Light.ttfbin0 -> 140276 bytes
-rwxr-xr-xnanovg/example/Roboto-Regular.ttfbin0 -> 145348 bytes
-rw-r--r--nanovg/example/entypo.ttfbin0 -> 35392 bytes
-rw-r--r--nanovg/example/images/image1.jpgbin0 -> 25760 bytes
-rw-r--r--nanovg/example/images/image10.jpgbin0 -> 3439 bytes
-rw-r--r--nanovg/example/images/image11.jpgbin0 -> 3818 bytes
-rw-r--r--nanovg/example/images/image12.jpgbin0 -> 5452 bytes
-rw-r--r--nanovg/example/images/image2.jpgbin0 -> 24091 bytes
-rw-r--r--nanovg/example/images/image3.jpgbin0 -> 29282 bytes
-rw-r--r--nanovg/example/images/image4.jpgbin0 -> 23830 bytes
-rw-r--r--nanovg/example/images/image5.jpgbin0 -> 27131 bytes
-rw-r--r--nanovg/example/images/image6.jpgbin0 -> 25116 bytes
-rw-r--r--nanovg/example/images/image7.jpgbin0 -> 25590 bytes
-rw-r--r--nanovg/example/images/image8.jpgbin0 -> 24607 bytes
-rw-r--r--nanovg/example/images/image9.jpgbin0 -> 4035 bytes
-rw-r--r--nanovg/example/screenshot-01.pngbin0 -> 989424 bytes
-rw-r--r--nanovg/example/screenshot-02.pngbin0 -> 229443 bytes
-rwxr-xr-xpugl/wafbin0 -> 97489 bytes
87 files changed, 89199 insertions, 1 deletions
diff --git a/.gitlab-ci.yml b/.gitlab-ci.yml
new file mode 100644
index 0000000..2ed8f99
--- /dev/null
+++ b/.gitlab-ci.yml
@@ -0,0 +1,78 @@
+ - build
+ - test
+ - deploy
+.variables_template: &variables_definition
+ variables:
+ BASE_NAME: "canvas_display.lv2"
+ PKG_CONFIG_PATH: "/opt/lv2/lib/pkgconfig:/opt/${CI_BUILD_NAME}/lib/pkgconfig:/usr/lib/${CI_BUILD_NAME}/pkgconfig"
+.common_template: &common_definition
+ <<: *variables_definition
+ stage: build
+ artifacts:
+ name: "${BASE_NAME}-$(cat VERSION)-${CI_BUILD_NAME}"
+ paths:
+ - "${BASE_NAME}-$(cat VERSION)/"
+.build_template: &build_definition
+ <<: *common_definition
+ script:
+ - meson --prefix="/opt/${CI_BUILD_NAME}" --libdir="lib" --cross-file "${CI_BUILD_NAME}" -Db_lto=false build
+ - sed -i -e '/framework/s/-Wl,-O1//g' -e '/framework/s/-Wl,--start-group//g' -e '/framework/s/-Wl,--end-group//g' -e '/framework/s/-Wl,-soname,.*dylib//g' build/build.ninja
+ - ninja -C build
+ - ninja -C build install
+ - mkdir -p "${BASE_NAME}-$(cat VERSION)/${CI_BUILD_NAME}/${BASE_NAME}"
+ - cp -r "/opt/${CI_BUILD_NAME}/lib/lv2/${BASE_NAME}/" "${BASE_NAME}-$(cat VERSION)/${CI_BUILD_NAME}/"
+.universal_linux_template: &universal_linux_definition
+ image: ventosus/universal-linux-gnu
+ <<: *build_definition
+.arm_linux_template: &arm_linux_definition
+ image: ventosus/arm-linux-gnueabihf
+ <<: *build_definition
+.universal_w64_template: &universal_w64_definition
+ image: ventosus/universal-w64-mingw32
+ <<: *build_definition
+.universal_apple_template: &universal_apple_definition
+ image: ventosus/universal-apple-darwin
+ <<: *build_definition
+# building in docker
+ before_script:
+ - apt-get install -y libglu1-mesa-dev
+ <<: *universal_linux_definition
+ before_script:
+ - apt-get install -y libglu1-mesa-dev:i386
+ <<: *universal_linux_definition
+ before_script:
+ - apt-get install -y libglu1-mesa-dev:armhf
+ <<: *arm_linux_definition
+ <<: *universal_w64_definition
+ <<: *universal_w64_definition
+ <<: *universal_apple_definition
+ <<: *variables_definition
+ stage: deploy
+ script:
+ - echo 'packing up...'
+ artifacts:
+ name: "${BASE_NAME}-$(cat VERSION)"
+ paths:
+ - "${BASE_NAME}-$(cat VERSION)/"
diff --git a/README.md b/README.md
index 06b87f2..d55c1ca 100644
--- a/README.md
+++ b/README.md
@@ -1,4 +1,30 @@
-# Canvas LV2 plugin extension
+# Canvas
+## Canvas LV2 plugin bundle
+### Webpage
+Get more information at: [http://open-music-kontrollers.ch/lv2/canvas](http://open-music-kontrollers.ch/lv2/canvas)
+### Build status
+[![build status](https://gitlab.com/OpenMusicKontrollers/canvas.lv2/badges/master/build.svg)](https://gitlab.com/OpenMusicKontrollers/canvas.lv2/commits/master)
+### Dependencies
+* [LV2](http://lv2plug.in) (LV2 Plugin Standard)
+* [pugl](http://drobilla.net/software/pugl) (Portable API for OpenGL GUIs)
+* [cairo](http://cairographics.org) (Cairo Vector Graphics Library)
+### Build / install
+ git clone https://github.com/OpenMusicKontrollers/canvas.lv2.git
+ cd canvas.lv2
+ mkdir build
+ cd build
+ cmake ..
+ make
+ sudo make install
### License
diff --git a/VERSION b/VERSION
new file mode 100644
index 0000000..0e4bed1
--- /dev/null
@@ -0,0 +1 @@
diff --git a/ardour.lv2/lv2_extensions.h b/ardour.lv2/lv2_extensions.h
new file mode 100644
index 0000000..64fc3bc
--- /dev/null
+++ b/ardour.lv2/lv2_extensions.h
@@ -0,0 +1,174 @@
+ Copyright 2016 Robin Gareus <robin@gareus.org>
+ Permission to use, copy, modify, and/or distribute this software for any
+ purpose with or without fee is hereby granted, provided that the above
+ copyright notice and this permission notice appear in all copies.
+#ifndef _ardour_lv2_extensions_h_
+#define _ardour_lv2_extensions_h_
+#include "lv2/lv2plug.in/ns/lv2core/lv2.h"
+ @defgroup inlinedisplay Inline-Display
+ Support for displaying a miniaturized generic view
+ directly in the host's Mixer Window.
+ @{
+#define LV2_INLINEDISPLAY_URI "http://harrisonconsoles.com/lv2/inlinedisplay"
+#define LV2_INLINEDISPLAY__interface LV2_INLINEDISPLAY_PREFIX "interface"
+#define LV2_INLINEDISPLAY__queue_draw LV2_INLINEDISPLAY_PREFIX "queue_draw"
+/** Opaque handle for LV2_Inline_Display::queue_draw() */
+typedef void* LV2_Inline_Display_Handle;
+/** raw image pixmap format is ARGB32,
+ * the data pointer is owned by the plugin and must be valid
+ * from the first call to render until cleanup.
+ */
+typedef struct {
+ unsigned char *data;
+ int width;
+ int height;
+ int stride;
+} LV2_Inline_Display_Image_Surface;
+/** a LV2 Feature provided by the Host to the plugin */
+typedef struct {
+ /** Opaque host data */
+ LV2_Inline_Display_Handle handle;
+ /** Request from run() that the host should call render() at a later time
+ * to update the inline display */
+ void (*queue_draw)(LV2_Inline_Display_Handle handle);
+} LV2_Inline_Display;
+ * Plugin Inline-Display Interface.
+ */
+typedef struct {
+ /**
+ * The render method. This is called by the host in a non-realtime context,
+ * usually the main GUI thread.
+ * The data pointer is owned by the plugin and must be valid
+ * from the first call to render until cleanup.
+ *
+ * @param instance The LV2 instance
+ * @param w the max available width
+ * @param h the max available height
+ * @return pointer to a LV2_Inline_Display_Image_Surface or NULL
+ */
+ LV2_Inline_Display_Image_Surface* (*render)(LV2_Handle instance, uint32_t w, uint32_t h);
+} LV2_Inline_Display_Interface;
+ @}
+ @defgroup automate Self-Automation
+ Support for plugins to write automation data via Atom Events
+ @{
+#define LV2_AUTOMATE_URI "http://ardour.org/lv2/automate"
+/** an lv2:optionalFeature */
+#define LV2_AUTOMATE_URI__can_write LV2_AUTOMATE_URI_PREFIX "canWriteAutomatation"
+/** atom:supports */
+#define LV2_AUTOMATE_URI__control LV2_AUTOMATE_URI_PREFIX "automationControl"
+/** lv2:portProperty */
+#define LV2_AUTOMATE_URI__controlled LV2_AUTOMATE_URI_PREFIX "automationControlled"
+#define LV2_AUTOMATE_URI__controller LV2_AUTOMATE_URI_PREFIX "automationController"
+/** atom messages */
+#define LV2_AUTOMATE_URI__event LV2_AUTOMATE_URI_PREFIX "event"
+#define LV2_AUTOMATE_URI__setup LV2_AUTOMATE_URI_PREFIX "setup"
+#define LV2_AUTOMATE_URI__finalize LV2_AUTOMATE_URI_PREFIX "finalize"
+#define LV2_AUTOMATE_URI__start LV2_AUTOMATE_URI_PREFIX "start"
+#define LV2_AUTOMATE_URI__parameter LV2_AUTOMATE_URI_PREFIX "parameter"
+#define LV2_AUTOMATE_URI__value LV2_AUTOMATE_URI_PREFIX "value"
+ @}
+ @defgroup license License-Report
+ Allow for commercial LV2 to report their
+ licensing status.
+ @{
+#define LV2_PLUGINLICENSE_URI "http://harrisonconsoles.com/lv2/license"
+#define LV2_PLUGINLICENSE__interface LV2_PLUGINLICENSE_PREFIX "interface"
+typedef struct _LV2_License_Interface {
+ /* @return -1 if no license is needed; 0 if unlicensed, 1 if licensed */
+ int (*is_licensed)(LV2_Handle instance);
+ /* @return a string copy of the licensee name if licensed, or NULL, the caller needs to free this */
+ char* (*licensee)(LV2_Handle instance);
+ /* @return a URI identifying the plugin-bundle or plugin for which a given license is valid */
+ const char* (*product_uri)(LV2_Handle instance);
+ /* @return human readable product name for the URI */
+ const char* (*product_name)(LV2_Handle instance);
+ /* @return link to website or webstore */
+ const char* (*store_url)(LV2_Handle instance);
+} LV2_License_Interface;
+ @}
+ @defgroup plugin provided bypass
+ A port with the designation "processing#enable" must
+ control a plugin's internal bypass mode.
+ If the port value is larger than zero the plugin processes
+ normally.
+ If the port value is zero, the plugin is expected to bypass
+ all signals unmodified.
+ The plugin is responsible for providing a click-free transition
+ between the states.
+ (values less than zero are reserved for future use:
+ e.g click-free insert/removal of latent plugins.
+ Generally values <= 0 are to be treated as bypassed.)
+ lv2:designation <http://ardour.org/lv2/processing#enable> ;
+ @{
+#define LV2_PROCESSING_URI "http://ardour.org/lv2/processing"
+ @}
diff --git a/canvas.c b/canvas.c
new file mode 100644
index 0000000..d97945c
--- /dev/null
+++ b/canvas.c
@@ -0,0 +1,720 @@
+ * Copyright (c) 2016 Hanspeter Portner (dev@open-music-kontrollers.ch)
+ *
+ * This is free software: you can redistribute it and/or modify
+ * it under the terms of the Artistic License 2.0 as published by
+ * The Perl Foundation.
+ *
+ * This source is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Artistic License 2.0 for more details.
+ *
+ * You should have received a copy of the Artistic License 2.0
+ * along the source as a COPYING file. If not, obtain it from
+ * http://www.perlfoundation.org/artistic_license_2_0.
+ */
+#include <stdlib.h>
+#include <stdio.h>
+#include <stdatomic.h>
+#include <inttypes.h>
+#include <lv2/lv2plug.in/ns/ext/patch/patch.h>
+#include <lv2/lv2plug.in/ns/ext/log/log.h>
+#include <lv2/lv2plug.in/ns/ext/log/logger.h>
+#include <canvas.lv2/forge.h>
+#include <canvas.lv2/render.h>
+#include <lv2_extensions.h>
+#include <cairo/cairo.h>
+//#define DEBUG
+#define MAX_GRAPH_BUF 0x10000
+typedef struct _plughandle_t plughandle_t;
+struct _plughandle_t {
+ LV2_URID_Map *map;
+ LV2_Atom_Forge forge;
+ LV2_Atom_Forge forge_through;
+ LV2_Log_Log *log;
+ LV2_Log_Logger logger;
+ const LV2_Atom_Sequence *control;
+ LV2_Atom_Sequence *notify;
+ LV2_URID patch_Get;
+ LV2_URID patch_Set;
+ LV2_URID patch_Put;
+ LV2_URID patch_property;
+ LV2_URID patch_value;
+ LV2_URID patch_body;
+ atomic_flag lock;
+ LV2_Inline_Display *queue_draw;
+ LV2_Inline_Display_Image_Surface image_surface;
+ struct {
+ cairo_surface_t *surface;
+ cairo_t *ctx;
+ } cairo;
+ LV2_Canvas canvas;
+ bool dirty;
+ float aspect_ratio;
+ union {
+ LV2_Atom_Tuple graph;
+ uint8_t buf [MAX_GRAPH_BUF];
+ };
+static inline void
+_spin_lock(atomic_flag *lock)
+ while(atomic_flag_test_and_set_explicit(lock, memory_order_acquire))
+ {
+ // spin
+ }
+static inline bool
+_try_lock(atomic_flag *lock)
+ return atomic_flag_test_and_set_explicit(lock, memory_order_acquire);
+static inline void
+_unlock(atomic_flag *lock)
+ atomic_flag_clear_explicit(lock, memory_order_release);
+static const float lv2_L [] = {
+ 0.05, 0.275,
+ 0.05, 0.73463521816969,
+ 0.39996786383766, 0.73463521816969,
+ 0.35805418792799, 0.61981755929103,
+ 0.16950515672412, 0.61981755929103,
+ 0.16950515672412, 0.275,
+ 0.05, 0.275
+static const float lv2_V [] = {
+ 0.44035674587458, 0.73463521816969,
+ 0.27321237521861, 0.275,
+ 0.39612954205777, 0.275,
+ 0.5215250619933, 0.61980400005209,
+ 0.64678627651808, 0.275,
+ 0.76999411666921, 0.275,
+ 0.60269884777111, 0.73463521816969,
+ 0.44035674587458, 0.73463521816969
+static inline LV2_Atom_Forge_Ref
+_lv2_logo_forge(LV2_Atom_Forge *forge, LV2_Canvas_URID *urid)
+ const uint32_t fg = 0xbb6600ff;
+ LV2_Atom_Forge_Ref ref;
+ if( (ref = lv2_canvas_forge_beginPath(forge, urid))
+ && (ref = lv2_canvas_forge_polyLine(forge, urid, sizeof(lv2_L)/sizeof(float), lv2_L))
+ && (ref = lv2_canvas_forge_closePath(forge, urid))
+ && (ref = lv2_canvas_forge_style(forge, urid, fg))
+ && (ref = lv2_canvas_forge_stroke(forge, urid))
+ && (ref = lv2_canvas_forge_beginPath(forge, urid))
+ && (ref = lv2_canvas_forge_polyLine(forge, urid, sizeof(lv2_L)/sizeof(float), lv2_V))
+ && (ref = lv2_canvas_forge_closePath(forge, urid))
+ && (ref = lv2_canvas_forge_style(forge, urid, fg))
+ && (ref = lv2_canvas_forge_stroke(forge, urid))
+ && (ref = lv2_canvas_forge_beginPath(forge, urid))
+ && (ref = lv2_canvas_forge_moveTo(forge, urid, 0.92679577564592, 0.33745757758451))
+ && (ref = lv2_canvas_forge_curveTo(forge, urid, 0.95, 0.37544661222032, 0.9486097413556,
+ 0.42890103900541, 0.91866073788306, 0.46581025262318))
+ && (ref = lv2_canvas_forge_curveTo(forge, urid, 0.87662774067075, 0.51761178520021,
+ 0.84865149155459, 0.52351773004551, 0.8188709443895, 0.55088574387747))
+ && (ref = lv2_canvas_forge_lineTo(forge, urid, 0.93798338878322, 0.55088574387747))
+ && (ref = lv2_canvas_forge_lineTo(forge, urid, 0.93798338878322, 0.61972641362727))
+ && (ref = lv2_canvas_forge_lineTo(forge, urid, 0.68857649440815, 0.61972641362727))
+ && (ref = lv2_canvas_forge_curveTo(forge, urid, 0.70410821191941, 0.57897193773781,
+ 0.71568706655441, 0.55649255812279, 0.73505227967577, 0.53436493734023))
+ && (ref = lv2_canvas_forge_curveTo(forge, urid, 0.78431409785481, 0.47807598612821,
+ 0.88073913173375, 0.44149338929647, 0.87483180798279, 0.39074363998918))
+ && (ref = lv2_canvas_forge_curveTo(forge, urid, 0.8731729385169, 0.37649219041461,
+ 0.86900905711197, 0.34385128732334, 0.80655313421425, 0.34385128732334))
+ && (ref = lv2_canvas_forge_lineTo(forge, urid, 0.7834998081023, 0.34385128732334))
+ && (ref = lv2_canvas_forge_lineTo(forge, urid, 0.80849192152801, 0.275))
+ && (ref = lv2_canvas_forge_curveTo(forge, urid, 0.88098903540187, 0.275,
+ 0.90879494370618, 0.30798728419169, 0.92679577564592, 0.33745757758451))
+ && (ref = lv2_canvas_forge_style(forge, urid, fg))
+ && (ref = lv2_canvas_forge_stroke(forge, urid)) )
+ {
+ return ref;
+ }
+ return 0;
+static LV2_Handle
+instantiate(const LV2_Descriptor* descriptor, double rate,
+ const char *bundle_path, const LV2_Feature *const *features)
+ plughandle_t *handle = calloc(1, sizeof(plughandle_t));
+ if(!handle)
+ return NULL;
+ for(unsigned i=0; features[i]; i++)
+ {
+ if(!strcmp(features[i]->URI, LV2_URID__map))
+ handle->map = features[i]->data;
+ else if(!strcmp(features[i]->URI, LV2_INLINEDISPLAY__queue_draw))
+ handle->queue_draw = features[i]->data;
+ else if(!strcmp(features[i]->URI, LV2_LOG__log))
+ handle->log = features[i]->data;
+ }
+ if(!handle->map)
+ {
+ fprintf(stderr,
+ "%s: Host does not support urid:map\n", descriptor->URI);
+ free(handle);
+ return NULL;
+ }
+ if(handle->log)
+ lv2_log_logger_init(&handle->logger, handle->map, handle->log);
+ handle->patch_Get = handle->map->map(handle->map->handle, LV2_PATCH__Get);
+ handle->patch_Set = handle->map->map(handle->map->handle, LV2_PATCH__Set);
+ handle->patch_Put = handle->map->map(handle->map->handle, LV2_PATCH__Put);
+ handle->patch_property = handle->map->map(handle->map->handle, LV2_PATCH__property);
+ handle->patch_value = handle->map->map(handle->map->handle, LV2_PATCH__value);
+ handle->patch_body = handle->map->map(handle->map->handle, LV2_PATCH__body);
+ lv2_atom_forge_init(&handle->forge, handle->map);
+ handle->lock = (atomic_flag)ATOMIC_FLAG_INIT;
+ lv2_canvas_init(&handle->canvas, handle->map);
+ handle->aspect_ratio = 1.f;
+ LV2_Atom_Forge_Frame frame;
+ lv2_atom_forge_set_buffer(&handle->forge, handle->buf, MAX_GRAPH_BUF);
+ LV2_Atom_Forge_Ref ref = lv2_atom_forge_tuple(&handle->forge, &frame);
+ if(ref)
+ ref = _lv2_logo_forge(&handle->forge, &handle->canvas.urid);
+ if(ref)
+ lv2_atom_forge_pop(&handle->forge, &frame);
+ handle->dirty = true;
+ return handle;
+static void
+connect_port(LV2_Handle instance, uint32_t port, void *data)
+ plughandle_t *handle = instance;
+ switch(port)
+ {
+ case 0:
+ handle->control = data;
+ break;
+ case 1:
+ handle->notify = data;
+ break;
+ default:
+ break;
+ }
+static LV2_Atom_Forge_Ref
+_forge_graph(plughandle_t *handle, int64_t frames)
+ const uint32_t szg = lv2_atom_total_size(&handle->graph.atom);
+ LV2_Atom_Forge_Frame obj_frame;
+ LV2_Atom_Forge_Ref ref = lv2_atom_forge_frame_time(&handle->forge, frames);
+ if(ref)
+ ref = lv2_atom_forge_object(&handle->forge, &obj_frame, 0, handle->patch_Set);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->patch_property);
+ if(ref)
+ ref = lv2_atom_forge_urid(&handle->forge, handle->canvas.urid.Canvas_graph);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->patch_value);
+ if(ref)
+ ref = lv2_atom_forge_write(&handle->forge, &handle->graph, szg);
+ if(ref)
+ lv2_atom_forge_pop(&handle->forge, &obj_frame);
+ return ref;
+static LV2_Atom_Forge_Ref
+_forge_aspect(plughandle_t *handle, int64_t frames)
+ LV2_Atom_Forge_Frame obj_frame;
+ LV2_Atom_Forge_Ref ref = lv2_atom_forge_frame_time(&handle->forge, frames);
+ if(ref)
+ ref = lv2_atom_forge_object(&handle->forge, &obj_frame, 0, handle->patch_Set);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->patch_property);
+ if(ref)
+ ref = lv2_atom_forge_urid(&handle->forge, handle->canvas.urid.Canvas_aspectRatio);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->patch_value);
+ if(ref)
+ ref = lv2_atom_forge_float(&handle->forge, handle->aspect_ratio);
+ if(ref)
+ lv2_atom_forge_pop(&handle->forge, &obj_frame);
+ return ref;
+static void
+run(LV2_Handle instance, uint32_t nsamples)
+ plughandle_t *handle = instance;
+ const uint32_t capacity = handle->notify->atom.size;
+ lv2_atom_forge_set_buffer(&handle->forge, (uint8_t *)handle->notify, capacity);
+ LV2_Atom_Forge_Frame frame;
+ LV2_Atom_Forge_Ref ref = lv2_atom_forge_sequence_head(&handle->forge, &frame, 0);
+ LV2_ATOM_SEQUENCE_FOREACH(handle->control, ev)
+ {
+ const LV2_Atom_Object *obj = (const LV2_Atom_Object *)&ev->body;
+ const uint32_t szo = lv2_atom_total_size(&obj->atom);
+ bool route = false;
+ if(lv2_atom_forge_is_object_type(&handle->forge, obj->atom.type))
+ {
+ if(obj->body.otype == handle->patch_Get)
+ {
+ const LV2_Atom_URID *property = NULL;
+ lv2_atom_object_get(obj, handle->patch_property, &property,
+ 0);
+ if(!property)
+ {
+ if(ref)
+ ref = _forge_aspect(handle, ev->time.frames);
+ if(ref)
+ ref = _forge_graph(handle, ev->time.frames);
+ }
+ if( property
+ && (property->atom.type == handle->forge.URID)
+ && (property->body == handle->canvas.urid.Canvas_graph) )
+ {
+ if(ref)
+ ref = _forge_graph(handle, ev->time.frames);
+ }
+ else if( property
+ && (property->atom.type == handle->forge.URID)
+ && (property->body == handle->canvas.urid.Canvas_aspectRatio) )
+ {
+ if(ref)
+ ref = _forge_aspect(handle, ev->time.frames);
+ }
+ }
+ else if(obj->body.otype == handle->patch_Set)
+ {
+ const LV2_Atom_URID *property = NULL;
+ const LV2_Atom *value = NULL;
+ lv2_atom_object_get(obj, handle->patch_property, &property,
+ handle->patch_value, &value,
+ 0);
+ if( property
+ && (property->atom.type == handle->forge.URID)
+ && value)
+ {
+ if( (property->body == handle->canvas.urid.Canvas_graph)
+ && (value->type == handle->forge.Tuple) )
+ {
+ const LV2_Atom_Tuple *graph = (const LV2_Atom_Tuple *)value;
+ const uint32_t szg = lv2_atom_total_size(&graph->atom);
+ if( (szg <= MAX_GRAPH_BUF)
+ && _try_lock(&handle->lock) )
+ {
+ memcpy(&handle->graph, graph, szg);
+ _unlock(&handle->lock);
+ if(handle->queue_draw)
+ handle->queue_draw->queue_draw(handle->queue_draw->handle);
+ }
+ route = true;
+ }
+ else if( (property->body == handle->canvas.urid.Canvas_aspectRatio)
+ && (value->type == handle->forge.Float) )
+ {
+ if( _try_lock(&handle->lock) )
+ {
+ handle->aspect_ratio = ((const LV2_Atom_Float *)value)->body;
+ _unlock(&handle->lock);
+ if(handle->queue_draw)
+ handle->queue_draw->queue_draw(handle->queue_draw->handle);
+ }
+ route = true;
+ }
+ else if( (property->body == handle->canvas.urid.Canvas_mouseButtonLeft)
+ && (value->type == handle->forge.Bool) )
+ {
+#ifdef DEBUG
+ if(handle->log)
+ {
+ lv2_log_trace(&handle->logger, "\tcanvas:mouseButtonLeft: %"PRIi32"\n",
+ ((const LV2_Atom_Bool *)value)->body);
+ }
+ route = true;
+ }
+ else if( (property->body == handle->canvas.urid.Canvas_mouseButtonMiddle)
+ && (value->type == handle->forge.Bool) )
+ {
+#ifdef DEBUG
+ if(handle->log)
+ {
+ lv2_log_trace(&handle->logger, "\tcanvas:mouseButtonMiddle: %"PRIi32"\n",
+ ((const LV2_Atom_Bool *)value)->body);
+ }
+ route = true;
+ }
+ else if( (property->body == handle->canvas.urid.Canvas_mouseButtonRight)
+ && (value->type == handle->forge.Bool) )
+ {
+#ifdef DEBUG
+ if(handle->log)
+ {
+ lv2_log_trace(&handle->logger, "\tcanvas:mouseButtonRight: %"PRIi32"\n",
+ ((const LV2_Atom_Bool *)value)->body);
+ }
+ route = true;
+ }
+ else if( (property->body == handle->canvas.urid.Canvas_mousePositionX)
+ && (value->type == handle->forge.Double) )
+ {
+#ifdef DEBUG
+ if(handle->log)
+ {
+ lv2_log_trace(&handle->logger, "\tcanvas:mousePositionX: %lf\n",
+ ((const LV2_Atom_Double *)value)->body);
+ }
+ route = true;
+ }
+ else if( (property->body == handle->canvas.urid.Canvas_mousePositionY)
+ && (value->type == handle->forge.Double) )
+ {
+#ifdef DEBUG
+ if(handle->log)
+ {
+ lv2_log_trace(&handle->logger, "\tcanvas:mousePositionY: %lf\n",
+ ((const LV2_Atom_Double *)value)->body);
+ }
+ route = true;
+ }
+ else if( (property->body == handle->canvas.urid.Canvas_mouseWheelX)
+ && (value->type == handle->forge.Double) )
+ {
+#ifdef DEBUG
+ if(handle->log)
+ {
+ lv2_log_trace(&handle->logger, "\tcanvas:mouseWheelX: %lf\n",
+ ((const LV2_Atom_Double *)value)->body);
+ }
+ route = true;
+ }
+ else if( (property->body == handle->canvas.urid.Canvas_mouseWheelY)
+ && (value->type == handle->forge.Double) )
+ {
+#ifdef DEBUG
+ if(handle->log)
+ {
+ lv2_log_trace(&handle->logger, "\tcanvas:mouseWheelY: %lf\n",
+ ((const LV2_Atom_Double *)value)->body);
+ }
+ route = true;
+ }
+ else if( (property->body == handle->canvas.urid.Canvas_mouseFocus)
+ && (value->type == handle->forge.Bool) )
+ {
+#ifdef DEBUG
+ if(handle->log)
+ {
+ lv2_log_trace(&handle->logger, "\tcanvas:mouseFocus: %"PRIi32"\n",
+ ((const LV2_Atom_Bool *)value)->body);
+ }
+ route = true;
+ }
+ }
+ }
+ else if(obj->body.otype == handle->patch_Put)
+ {
+ const LV2_Atom_Object *body = NULL;
+ lv2_atom_object_get(obj, handle->patch_body, &body,
+ 0);
+ if( body
+ && lv2_atom_forge_is_object_type(&handle->forge, body->atom.type) )
+ {
+ const LV2_Atom_Bool *l = NULL;
+ const LV2_Atom_Bool *m = NULL;
+ const LV2_Atom_Bool *r = NULL;
+ const LV2_Atom_Double *dx = NULL;
+ const LV2_Atom_Double *dy = NULL;
+ const LV2_Atom_Double *x = NULL;
+ const LV2_Atom_Double *y = NULL;
+ const LV2_Atom_Bool *f = NULL;
+ lv2_atom_object_get(body,
+ handle->canvas.urid.Canvas_mouseButtonLeft, &l,
+ handle->canvas.urid.Canvas_mouseButtonMiddle, &m,
+ handle->canvas.urid.Canvas_mouseButtonRight, &r,
+ handle->canvas.urid.Canvas_mouseWheelX, &dx,
+ handle->canvas.urid.Canvas_mouseWheelY, &dy,
+ handle->canvas.urid.Canvas_mousePositionX, &x,
+ handle->canvas.urid.Canvas_mousePositionY, &y,
+ handle->canvas.urid.Canvas_mouseFocus, &f,
+ 0);
+#ifdef DEBUG
+ if(handle->log)
+ {
+ lv2_log_trace(&handle->logger, "{\n");
+ if(l && (l->atom.type == handle->forge.Bool) )
+ lv2_log_trace(&handle->logger, "\tcanvas:mousebuttonLeft: %"PRIi32"\n", l->body);
+ if(m && (m->atom.type == handle->forge.Bool) )
+ lv2_log_trace(&handle->logger, "\tcanvas:mousebuttonMiddle: %"PRIi32"\n", m->body);
+ if(r && (r->atom.type == handle->forge.Bool) )
+ lv2_log_trace(&handle->logger, "\tcanvas:mousebuttonRight: %"PRIi32"\n", r->body);
+ if(x && (x->atom.type == handle->forge.Double) )
+ lv2_log_trace(&handle->logger, "\tcanvas:mousePositionX: %lf\n", x->body);
+ if(y && (y->atom.type == handle->forge.Double) )
+ lv2_log_trace(&handle->logger, "\tcanvas:mousePositionY: %lf\n", y->body);
+ if(dx && (dx->atom.type == handle->forge.Double) )
+ lv2_log_trace(&handle->logger, "\tcanvas:mouseWheelX: %lf\n", dx->body);
+ if(dy && (dy->atom.type == handle->forge.Double) )
+ lv2_log_trace(&handle->logger, "\tcanvas:mouseWheelY: %lf\n", dy->body);
+ if(f && (f->atom.type == handle->forge.Bool) )
+ lv2_log_trace(&handle->logger, "\tcanvas:mouseFocus: %"PRIi32"\n", f->body);
+ lv2_log_trace(&handle->logger, "}\n");
+ }
+ if( x && (x->atom.type == handle->forge.Double)
+ && y && (y->atom.type == handle->forge.Double) )
+ route = true; // a valid input event at least sets x and y
+ }
+ }
+ }
+ if(route) // should we route to UI?
+ {
+ if(ref)
+ ref = lv2_atom_forge_frame_time(&handle->forge, ev->time.frames);
+ if(ref)
+ ref = lv2_atom_forge_write(&handle->forge, obj, szo);
+ }
+ }
+ if(handle->dirty)
+ {
+ if(handle->queue_draw)
+ handle->queue_draw->queue_draw(handle->queue_draw->handle);
+ if(ref)
+ ref = _forge_aspect(handle, nsamples-1);
+ if(ref)
+ ref = _forge_graph(handle, nsamples-1);
+ handle->dirty = false;
+ }
+ if(ref)
+ lv2_atom_forge_pop(&handle->forge, &frame);
+ else
+ lv2_atom_sequence_clear(handle->notify);
+static inline LV2_Inline_Display_Image_Surface *
+_cairo_init(plughandle_t *handle, int w, int h)
+ LV2_Inline_Display_Image_Surface *surf = &handle->image_surface;
+ surf->width = w;
+ surf->height = w > h ? h : w; // try to use 1:1 ratio
+ surf->stride = cairo_format_stride_for_width(CAIRO_FORMAT_ARGB32, surf->width);
+ surf->data = realloc(surf->data, surf->stride * surf->height);
+ if(!surf->data)
+ return NULL;
+ handle->cairo.surface = cairo_image_surface_create_for_data(
+ surf->data, CAIRO_FORMAT_ARGB32, surf->width, surf->height, surf->stride);
+ if(handle->cairo.surface)
+ {
+ cairo_surface_set_device_scale(handle->cairo.surface, surf->width, surf->height);
+ handle->cairo.ctx = cairo_create(handle->cairo.surface);
+ if(handle->cairo.ctx)
+ {
+ cairo_select_font_face(handle->cairo.ctx, "cairo:monospace", CAIRO_FONT_SLANT_NORMAL, CAIRO_FONT_WEIGHT_NORMAL);
+ }
+ }
+ return surf;
+static inline void
+_cairo_deinit(plughandle_t *handle)
+ LV2_Inline_Display_Image_Surface *surf = &handle->image_surface;
+ if(handle->cairo.ctx)
+ {
+ cairo_destroy(handle->cairo.ctx);
+ handle->cairo.ctx = NULL;
+ }
+ if(handle->cairo.surface)
+ {
+ cairo_surface_finish(handle->cairo.surface);
+ cairo_surface_destroy(handle->cairo.surface);
+ handle->cairo.surface = NULL;
+ }
+ if(surf->data)
+ {
+ free(surf->data);
+ surf->data = NULL;
+ }
+// non-rt
+static LV2_Inline_Display_Image_Surface *
+_render(LV2_Handle instance, uint32_t w, uint32_t h)
+ plughandle_t *handle = instance;
+ LV2_Inline_Display_Image_Surface *surf = &handle->image_surface;
+ int W;
+ int H;
+ if(handle->aspect_ratio == 0.f)
+ {
+ W = w;
+ H = h;
+ }
+ else if(handle->aspect_ratio <= 1.f)
+ {
+ W = h * handle->aspect_ratio;
+ H = h;
+ }
+ else if(handle->aspect_ratio > 1.f)
+ {
+ W = w;
+ H = w / handle->aspect_ratio;
+ }
+ if( (surf->width != W) || (surf->height != H) || !surf->data)
+ {
+ _cairo_deinit(handle);
+ surf = _cairo_init(handle, W, H);
+ }
+ if(!surf)
+ return NULL;
+ _spin_lock(&handle->lock);
+ lv2_canvas_render(&handle->canvas, handle->cairo.ctx, &handle->graph);
+ _unlock(&handle->lock);
+ return surf;
+static const LV2_Inline_Display_Interface idisp_iface = {
+ .render = _render
+static void
+cleanup(LV2_Handle instance)
+ plughandle_t *handle = instance;
+ _cairo_deinit(handle);
+ if(handle->image_surface.data)
+ free(handle->image_surface.data);
+ free(handle);
+static const void *
+extension_data(const char *uri)
+ if(!strcmp(uri, LV2_INLINEDISPLAY__interface))
+ return &idisp_iface;
+ return NULL;
+const LV2_Descriptor canvas_canvas = {
+ .URI = CANVAS_PREFIX"display",
+ .instantiate = instantiate,
+ .connect_port = connect_port,
+ .activate = NULL,
+ .run = run,
+ .deactivate = NULL,
+ .cleanup = cleanup,
+ .extension_data = extension_data
+LV2_SYMBOL_EXPORT const LV2_Descriptor*
+lv2_descriptor(uint32_t index)
+ switch(index)
+ {
+ case 0:
+ return &canvas_canvas;
+ default:
+ return NULL;
+ }
diff --git a/canvas.lv2/COPYING b/canvas.lv2/COPYING
new file mode 100644
index 0000000..ddb9a46
--- /dev/null
+++ b/canvas.lv2/COPYING
@@ -0,0 +1,201 @@
+ The Artistic License 2.0
+ Copyright (c) 2000-2006, The Perl Foundation.
+ Everyone is permitted to copy and distribute verbatim copies
+ of this license document, but changing it is not allowed.
+This license establishes the terms under which a given free software
+Package may be copied, modified, distributed, and/or redistributed.
+The intent is that the Copyright Holder maintains some artistic
+control over the development of that Package while still keeping the
+Package available as open source and free software.
+You are always permitted to make arrangements wholly outside of this
+license directly with the Copyright Holder of a given Package. If the
+terms of this license do not permit the full use that you propose to
+make of the Package, you should contact the Copyright Holder and seek
+a different licensing arrangement.
+ "Copyright Holder" means the individual(s) or organization(s)
+ named in the copyright notice for the entire Package.
+ "Contributor" means any party that has contributed code or other
+ material to the Package, in accordance with the Copyright Holder's
+ procedures.
+ "You" and "your" means any person who would like to copy,
+ distribute, or modify the Package.
+ "Package" means the collection of files distributed by the
+ Copyright Holder, and derivatives of that collection and/or of
+ those files. A given Package may consist of either the Standard
+ Version, or a Modified Version.
+ "Distribute" means providing a copy of the Package or making it
+ accessible to anyone else, or in the case of a company or
+ organization, to others outside of your company or organization.
+ "Distributor Fee" means any fee that you charge for Distributing
+ this Package or providing support for this Package to another
+ party. It does not mean licensing fees.
+ "Standard Version" refers to the Package if it has not been
+ modified, or has been modified only in ways explicitly requested
+ by the Copyright Holder.
+ "Modified Version" means the Package, if it has been changed, and
+ such changes were not explicitly requested by the Copyright
+ Holder.
+ "Original License" means this Artistic License as Distributed with
+ the Standard Version of the Package, in its current version or as
+ it may be modified by The Perl Foundation in the future.
+ "Source" form means the source code, documentation source, and
+ configuration files for the Package.
+ "Compiled" form means the compiled bytecode, object code, binary,
+ or any other form resulting from mechanical transformation or
+ translation of the Source form.
+Permission for Use and Modification Without Distribution
+(1) You are permitted to use the Standard Version and create and use
+Modified Versions for any purpose without restriction, provided that
+you do not Distribute the Modified Version.
+Permissions for Redistribution of the Standard Version
+(2) You may Distribute verbatim copies of the Source form of the
+Standard Version of this Package in any medium without restriction,
+either gratis or for a Distributor Fee, provided that you duplicate
+all of the original copyright notices and associated disclaimers. At
+your discretion, such verbatim copies may or may not include a
+Compiled form of the Package.
+(3) You may apply any bug fixes, portability changes, and other
+modifications made available from the Copyright Holder. The resulting
+Package will still be considered the Standard Version, and as such
+will be subject to the Original License.
+Distribution of Modified Versions of the Package as Source
+(4) You may Distribute your Modified Version as Source (either gratis
+or for a Distributor Fee, and with or without a Compiled form of the
+Modified Version) provided that you clearly document how it differs
+from the Standard Version, including, but not limited to, documenting
+any non-standard features, executables, or modules, and provided that
+you do at least ONE of the following:
+ (a) make the Modified Version available to the Copyright Holder
+ of the Standard Version, under the Original License, so that the
+ Copyright Holder may include your modifications in the Standard
+ Version.
+ (b) ensure that installation of your Modified Version does not
+ prevent the user installing or running the Standard Version. In
+ addition, the Modified Version must bear a name that is different
+ from the name of the Standard Version.
+ (c) allow anyone who receives a copy of the Modified Version to
+ make the Source form of the Modified Version available to others
+ under
+ (i) the Original License or
+ (ii) a license that permits the licensee to freely copy,
+ modify and redistribute the Modified Version using the same
+ licensing terms that apply to the copy that the licensee
+ received, and requires that the Source form of the Modified
+ Version, and of any works derived from it, be made freely
+ available in that license fees are prohibited but Distributor
+ Fees are allowed.
+Distribution of Compiled Forms of the Standard Version
+or Modified Versions without the Source
+(5) You may Distribute Compiled forms of the Standard Version without
+the Source, provided that you include complete instructions on how to
+get the Source of the Standard Version. Such instructions must be
+valid at the time of your distribution. If these instructions, at any
+time while you are carrying out such distribution, become invalid, you
+must provide new instructions on demand or cease further distribution.
+If you provide valid instructions or cease distribution within thirty
+days after you become aware that the instructions are invalid, then
+you do not forfeit any of your rights under this license.
+(6) You may Distribute a Modified Version in Compiled form without
+the Source, provided that you comply with Section 4 with respect to
+the Source of the Modified Version.
+Aggregating or Linking the Package
+(7) You may aggregate the Package (either the Standard Version or
+Modified Version) with other packages and Distribute the resulting
+aggregation provided that you do not charge a licensing fee for the
+Package. Distributor Fees are permitted, and licensing fees for other
+components in the aggregation are permitted. The terms of this license
+apply to the use and Distribution of the Standard or Modified Versions
+as included in the aggregation.
+(8) You are permitted to link Modified and Standard Versions with
+other works, to embed the Package in a larger work of your own, or to
+build stand-alone binary or bytecode versions of applications that
+include the Package, and Distribute the result without restriction,
+provided the result does not expose a direct interface to the Package.
+Items That are Not Considered Part of a Modified Version
+(9) Works (including, but not limited to, modules and scripts) that
+merely extend or make use of the Package, do not, by themselves, cause
+the Package to be a Modified Version. In addition, such works are not
+considered parts of the Package itself, and are not subject to the
+terms of this license.
+General Provisions
+(10) Any use, modification, and distribution of the Standard or
+Modified Versions is governed by this Artistic License. By using,
+modifying or distributing the Package, you accept this license. Do not
+use, modify, or distribute the Package, if you do not accept this
+(11) If your Modified Version has been derived from a Modified
+Version made by someone other than you, you are nevertheless required
+to ensure that your Modified Version complies with the requirements of
+this license.
+(12) This license does not grant you the right to use any trademark,
+service mark, tradename, or logo of the Copyright Holder.
+(13) This license includes the non-exclusive, worldwide,
+free-of-charge patent license to make, have made, use, offer to sell,
+sell, import and otherwise transfer the Package with respect to any
+patent claims licensable by the Copyright Holder that are necessarily
+infringed by the Package. If you institute patent litigation
+(including a cross-claim or counterclaim) against any party alleging
+that the Package constitutes direct or contributory patent
+infringement, then this Artistic License to you shall terminate on the
+date that such litigation is filed.
+(14) Disclaimer of Warranty:
diff --git a/canvas.lv2/README.md b/canvas.lv2/README.md
new file mode 100644
index 0000000..06b87f2
--- /dev/null
+++ b/canvas.lv2/README.md
@@ -0,0 +1,18 @@
+# Canvas LV2 plugin extension
+### License
+Copyright (c) 2016 Hanspeter Portner (dev@open-music-kontrollers.ch)
+This is free software: you can redistribute it and/or modify
+it under the terms of the Artistic License 2.0 as published by
+The Perl Foundation.
+This source is distributed in the hope that it will be useful,
+but WITHOUT ANY WARRANTY; without even the implied warranty of
+Artistic License 2.0 for more details.
+You should have received a copy of the Artistic License 2.0
+along the source as a COPYING file. If not, obtain it from
diff --git a/canvas.lv2/canvas.h b/canvas.lv2/canvas.lv2/canvas.h
index 7cca0fa..7cca0fa 100644
--- a/canvas.lv2/canvas.h
+++ b/canvas.lv2/canvas.lv2/canvas.h
diff --git a/canvas.lv2/forge.h b/canvas.lv2/canvas.lv2/forge.h
index c5ce5fe..c5ce5fe 100644
--- a/canvas.lv2/forge.h
+++ b/canvas.lv2/canvas.lv2/forge.h
diff --git a/canvas.lv2/render.h b/canvas.lv2/canvas.lv2/render.h
index af539aa..af539aa 100644
--- a/canvas.lv2/render.h
+++ b/canvas.lv2/canvas.lv2/render.h
diff --git a/canvas.lv2/render_cairo.h b/canvas.lv2/canvas.lv2/render_cairo.h
index 86c3ec9..86c3ec9 100644
--- a/canvas.lv2/render_cairo.h
+++ b/canvas.lv2/canvas.lv2/render_cairo.h
diff --git a/canvas.lv2/render_nanovg.h b/canvas.lv2/canvas.lv2/render_nanovg.h
index 3051afa..3051afa 100644
--- a/canvas.lv2/render_nanovg.h
+++ b/canvas.lv2/canvas.lv2/render_nanovg.h
diff --git a/canvas_display.ttl b/canvas_display.ttl
new file mode 100644
index 0000000..7932fd4
--- /dev/null
+++ b/canvas_display.ttl
@@ -0,0 +1,109 @@
+# Copyright (c) 2016 Hanspeter Portner (dev@open-music-kontrollers.ch)
+# This is free software: you can redistribute it and/or modify
+# it under the terms of the Artistic License 2.0 as published by
+# The Perl Foundation.
+# This source is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# Artistic License 2.0 for more details.
+# You should have received a copy of the Artistic License 2.0
+# along the source as a COPYING file. If not, obtain it from
+# http://www.perlfoundation.org/artistic_license_2_0.
+@prefix foaf: <http://xmlns.com/foaf/0.1/> .
+@prefix doap: <http://usefulinc.com/ns/doap#> .
+@prefix rdfs: <http://www.w3.org/2000/01/rdf-schema#> .
+@prefix rdf: <http://www.w3.org/1999/02/22-rdf-syntax-ns#> .
+@prefix lv2: <http://lv2plug.in/ns/lv2core#> .
+@prefix atom: <http://lv2plug.in/ns/ext/atom#> .
+@prefix urid: <http://lv2plug.in/ns/ext/urid#> .
+@prefix log: <http://lv2plug.in/ns/ext/log#> .
+@prefix patch: <http://lv2plug.in/ns/ext/patch#> .
+@prefix state: <http://lv2plug.in/ns/ext/state#> .
+@prefix idisp: <http://harrisonconsoles.com/lv2/inlinedisplay#> .
+@prefix lic: <http://opensource.org/licenses/> .
+@prefix omk: <http://open-music-kontrollers.ch/ventosus#> .
+@prefix proj: <http://open-music-kontrollers.ch/lv2/> .
+@prefix canvas: <http://open-music-kontrollers.ch/lv2/canvas#> .
+# to please sord_validate
+ a lv2:Feature .
+ a lv2:ExtensionData .
+# Maintainer
+ a foaf:Person ;
+ foaf:name "Hanspeter Portner" ;
+ foaf:mbox <mailto:dev@open-music-kontrollers.ch> ;
+ foaf:homepage <http://open-music-kontrollers.ch> .
+# Project
+ a doap:Project ;
+ doap:maintainer omk:me ;
+ doap:name "Canvas Bundle" .
+# Parameters
+ a lv2:Parameter ;
+ rdfs:range atom:Tuple ;
+ rdfs:label "graph" ;
+ rdfs:comment "Canvas graph" .
+ a lv2:Parameter ;
+ rdfs:range atom:Float ;
+ rdfs:label "aspectRatio" ;
+ rdfs:comment "Aspect Ratio" ;
+ lv2:minimum 0.25 ;
+ lv2:maximum 4.0 ;
+ lv2:default 1.0 .
+# Canvas Plugin
+ a lv2:Plugin,
+ lv2:AnalyserPlugin ;
+ doap:name "Canvas Display" ;
+ doap:license lic:Artistic-2.0 ;
+ lv2:project proj:canvas ;
+ lv2:requiredFeature urid:map ;
+ lv2:optionalFeature lv2:isLive, lv2:hardRTCapable, idisp:queue_draw, log:log ;
+ lv2:extensionData idisp:interface ;
+ lv2:port [
+ a lv2:InputPort ,
+ atom:AtomPort ;
+ atom:bufferType atom:Sequence ;
+ atom:supports patch:Message ;
+ lv2:index 0 ;
+ lv2:symbol "control" ;
+ lv2:name "Control" ;
+ lv2:designation lv2:control ;
+ ] , [
+ a lv2:OutputPort ,
+ atom:AtomPort ;
+ atom:bufferType atom:Sequence ;
+ atom:supports patch:Message ;
+ lv2:index 1 ;
+ lv2:symbol "notify" ;
+ lv2:name "Notify" ;
+ lv2:designation lv2:control ;
+ ] ;
+ patch:writable
+ canvas:aspectRatio ,
+ canvas:graph ;
+ state:state [
+ canvas:aspectRatio 1.0 ;
+ canvas:graph [
+ a atom:Tuple ;
+ rdf:value (
+ )
+ ] ;
+ ] .
diff --git a/canvas_display_ui.ttl b/canvas_display_ui.ttl
new file mode 100644
index 0000000..951317e
--- /dev/null
+++ b/canvas_display_ui.ttl
@@ -0,0 +1,30 @@
+# Copyright (c) 2016 Hanspeter Portner (dev@open-music-kontrollers.ch)
+# This is free software: you can redistribute it and/or modify
+# it under the terms of the Artistic License 2.0 as published by
+# The Perl Foundation.
+# This source is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# Artistic License 2.0 for more details.
+# You should have received a copy of the Artistic License 2.0
+# along the source as a COPYING file. If not, obtain it from
+# http://www.perlfoundation.org/artistic_license_2_0.
+@prefix lv2: <http://lv2plug.in/ns/lv2core#> .
+@prefix ui: <http://lv2plug.in/ns/extensions/ui#> .
+@prefix atom: <http://lv2plug.in/ns/ext/atom#> .
+@prefix urid: <http://lv2plug.in/ns/ext/urid#> .
+@prefix canvas: <http://open-music-kontrollers.ch/lv2/canvas#> .
+ ui:portNotification [
+ ui:plugin canvas:display ;
+ lv2:symbol "notify" ;
+ ui:protocol atom:eventTransfer
+ ] ;
+ lv2:requiredFeature ui:idleInterface, urid:map, ui:portMap ;
+ lv2:extensionData ui:idleInterface .
diff --git a/canvas_ui.c b/canvas_ui.c
new file mode 100644
index 0000000..b693a75
--- /dev/null
+++ b/canvas_ui.c
@@ -0,0 +1,606 @@
+ * Copyright (c) 2016 Hanspeter Portner (dev@open-music-kontrollers.ch)
+ *
+ * This is free software: you can redistribute it and/or modify
+ * it under the terms of the Artistic License 2.0 as published by
+ * The Perl Foundation.
+ *
+ * This source is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Artistic License 2.0 for more details.
+ *
+ * You should have received a copy of the Artistic License 2.0
+ * along the source as a COPYING file. If not, obtain it from
+ * http://www.perlfoundation.org/artistic_license_2_0.
+ */
+#include <stdlib.h>
+#include <stdio.h>
+#include <math.h>
+#include <lv2/lv2plug.in/ns/ext/patch/patch.h>
+#include <lv2/lv2plug.in/ns/extensions/ui/ui.h>
+#include <pugl/pugl.h>
+#include <canvas.lv2/forge.h>
+#include <canvas.lv2/render.h>
+typedef struct _plughandle_t plughandle_t;
+struct _plughandle_t {
+ LV2_URID_Map *map;
+ LV2_Atom_Forge forge;
+ LV2UI_Resize *host_resize;
+ PuglView *view;
+ int done;
+ LV2_Canvas canvas;
+ LV2_URID patch_Get;
+ LV2_URID patch_Set;
+ LV2_URID patch_Put;
+ LV2_URID patch_property;
+ LV2_URID patch_value;
+ LV2_URID patch_body;
+ LV2_URID atom_eventTransfer;
+ LV2_URID control_idx;
+ float aspect_ratio;
+ LV2_Atom_Tuple *graph;
+ LV2UI_Write_Function writer;
+ LV2UI_Controller controller;
+ NVGcontext *ctx;
+ unsigned w;
+ unsigned h;
+ union {
+ LV2_Atom atom;
+ uint8_t buf [512];
+ } dst;
+static inline void
+_event_request(plughandle_t *handle)
+ lv2_atom_forge_set_buffer(&handle->forge, handle->dst.buf, 512);
+static inline void
+_event_commit(plughandle_t *handle)
+ const uint32_t sz = lv2_atom_total_size(&handle->dst.atom);
+ handle->writer(handle->controller, handle->control_idx,
+ sz, handle->atom_eventTransfer, &handle->dst.atom);
+static inline void
+_refresh(plughandle_t *handle)
+ LV2_Atom_Forge_Frame obj_frame;
+ LV2_Atom_Forge_Ref ref;
+ _event_request(handle);
+ ref = lv2_atom_forge_object(&handle->forge, &obj_frame, 0, handle->patch_Get);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->patch_property);
+ if(ref)
+ ref = lv2_atom_forge_urid(&handle->forge, handle->canvas.urid.Canvas_aspectRatio);
+ if(ref)
+ lv2_atom_forge_pop(&handle->forge, &obj_frame);
+ if(ref)
+ _event_commit(handle);
+ _event_request(handle);
+ ref = lv2_atom_forge_object(&handle->forge, &obj_frame, 0, handle->patch_Get);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->patch_property);
+ if(ref)
+ ref = lv2_atom_forge_urid(&handle->forge, handle->canvas.urid.Canvas_graph);
+ if(ref)
+ lv2_atom_forge_pop(&handle->forge, &obj_frame);
+ if(ref)
+ _event_commit(handle);
+static inline LV2_Atom_Forge_Ref
+_input_request(plughandle_t *handle, LV2_Atom_Forge_Frame frame [2])
+ LV2_Atom_Forge_Ref ref;
+ _event_request(handle);
+ ref = lv2_atom_forge_object(&handle->forge, &frame[0], 0, handle->patch_Put);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->patch_body);
+ if(ref)
+ ref = lv2_atom_forge_object(&handle->forge, &frame[1], 0, 0);
+ return ref;
+static inline void
+_input_commit(plughandle_t *handle, LV2_Atom_Forge_Frame frame [2])
+ lv2_atom_forge_pop(&handle->forge, &frame[1]);
+ lv2_atom_forge_pop(&handle->forge, &frame[0]);
+ _event_commit(handle);
+static inline void
+_expose(plughandle_t *handle)
+ glViewport(0, 0, handle->w, handle->h);
+ glClearColor(0.3f, 0.3f, 0.32f, 1.0f);
+ nvgBeginFrame(handle->ctx, handle->w, handle->h, 1.f);
+ nvgSave(handle->ctx);
+ nvgScale(handle->ctx, handle->w, handle->h);
+ lv2_canvas_render(&handle->canvas, handle->ctx, handle->graph);
+ nvgRestore(handle->ctx);
+ nvgEndFrame(handle->ctx);
+static inline void
+_close(plughandle_t *handle)
+ handle->done = 1;
+static inline void
+_configure(plughandle_t *handle, const PuglEventConfigure *e)
+ handle->w = e->width;
+ handle->h = e->height;
+static void
+_relative_position(PuglView *view, double xa, double ya, double *xr, double *yr)
+ int width;
+ int height;
+ puglGetSize(view, &width, &height);
+ *xr = (double)xa / width;
+ *yr = (double)ya / height;
+static void
+_event_func(PuglView *view, const PuglEvent *e)
+ plughandle_t *handle = puglGetHandle(view);
+ LV2_Atom_Forge_Ref ref;
+ LV2_Atom_Forge_Frame frame [2];
+ switch(e->type)
+ {
+ {
+ _configure(handle, (const PuglEventConfigure *)e);
+ puglPostRedisplay(handle->view);
+ } break;
+ {
+ _expose(handle);
+ } break;
+ case PUGL_CLOSE:
+ {
+ _close(handle);
+ } break;
+ // fall-through
+ {
+ puglPostRedisplay(handle->view);
+ } break;
+ {
+ double x, y;
+ _relative_position(view, e->crossing.x, e->crossing.y, &x, &y);
+ ref = _input_request(handle, frame);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->canvas.urid.Canvas_mousePositionX);
+ if(ref)
+ ref = lv2_atom_forge_double(&handle->forge, x);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->canvas.urid.Canvas_mousePositionY);
+ if(ref)
+ ref = lv2_atom_forge_double(&handle->forge, y);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->canvas.urid.Canvas_mouseFocus);
+ if(ref)
+ ref = lv2_atom_forge_bool(&handle->forge, e->type == PUGL_ENTER_NOTIFY ? 1 : 0);
+ if(ref)
+ _input_commit(handle, frame);
+ puglPostRedisplay(handle->view);
+ } break;
+ {
+ double x, y;
+ _relative_position(view, e->button.x, e->button.y, &x, &y);
+ ref = _input_request(handle, frame);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->canvas.urid.Canvas_mousePositionX);
+ if(ref)
+ ref = lv2_atom_forge_double(&handle->forge, x);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->canvas.urid.Canvas_mousePositionY);
+ if(ref)
+ ref = lv2_atom_forge_double(&handle->forge, y);
+ LV2_URID button_urid;
+ switch(e->button.button)
+ {
+ case 3:
+ button_urid = handle->canvas.urid.Canvas_mouseButtonRight;
+ break;
+ case 2:
+ button_urid = handle->canvas.urid.Canvas_mouseButtonMiddle;
+ break;
+ case 1:
+ default:
+ button_urid = handle->canvas.urid.Canvas_mouseButtonLeft;
+ break;
+ }
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, button_urid);
+ if(ref)
+ ref = lv2_atom_forge_bool(&handle->forge, e->type == PUGL_BUTTON_PRESS ? 1 : 0);
+ if(ref)
+ _input_commit(handle, frame);
+ } break;
+ {
+ double x, y;
+ _relative_position(view, e->motion.x, e->motion.y, &x, &y);
+ ref = _input_request(handle, frame);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->canvas.urid.Canvas_mousePositionX);
+ if(ref)
+ ref = lv2_atom_forge_double(&handle->forge, x);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->canvas.urid.Canvas_mousePositionY);
+ if(ref)
+ ref = lv2_atom_forge_double(&handle->forge, y);
+ if(ref)
+ _input_commit(handle, frame);
+ } break;
+ {
+ double x, y;
+ _relative_position(view, e->scroll.x, e->scroll.y, &x, &y);
+ ref = _input_request(handle, frame);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->canvas.urid.Canvas_mousePositionX);
+ if(ref)
+ ref = lv2_atom_forge_double(&handle->forge, x);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->canvas.urid.Canvas_mousePositionY);
+ if(ref)
+ ref = lv2_atom_forge_double(&handle->forge, y);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->canvas.urid.Canvas_mouseWheelX);
+ if(ref)
+ ref = lv2_atom_forge_double(&handle->forge, e->scroll.dx);
+ if(ref)
+ ref = lv2_atom_forge_key(&handle->forge, handle->canvas.urid.Canvas_mouseWheelY);
+ if(ref)
+ ref = lv2_atom_forge_double(&handle->forge, e->scroll.dy);
+ if(ref)
+ _input_commit(handle, frame);
+ } break;
+ // fall-through
+ // fall-through
+ // fall-through
+ {
+ // nothing
+ } break;
+ }
+static LV2UI_Handle
+instantiate(const LV2UI_Descriptor *descriptor, const char *plugin_uri,
+ const char *bundle_path, LV2UI_Write_Function write_function,
+ LV2UI_Controller controller, LV2UI_Widget *widget,
+ const LV2_Feature *const *features)
+ plughandle_t *handle= calloc(1, sizeof(plughandle_t));
+ if(!handle)
+ return NULL;
+ void *parent = NULL;
+ LV2UI_Port_Map *pmap = NULL;
+ for(int i=0; features[i]; i++)
+ {
+ if(!strcmp(features[i]->URI, LV2_UI__parent))
+ parent = features[i]->data;
+ else if(!strcmp(features[i]->URI, LV2_UI__resize))
+ handle->host_resize = features[i]->data;
+ else if(!strcmp(features[i]->URI, LV2_URID__map))
+ handle->map = features[i]->data;
+ else if(!strcmp(features[i]->URI, LV2_UI__portMap))
+ pmap = features[i]->data;
+ }
+ if(!parent)
+ {
+ fprintf(stderr,
+ "%s: Host does not support ui:parent\n", descriptor->URI);
+ free(handle);
+ return NULL;
+ }
+ if(!handle->map)
+ {
+ fprintf(stderr,
+ "%s: Host does not support urid:map\n", descriptor->URI);
+ free(handle);
+ return NULL;
+ }
+ if(!pmap)
+ {
+ fprintf(stderr,
+ "%s: Host does not support ui:portMap\n", descriptor->URI);
+ free(handle);
+ return NULL;
+ }
+ handle->control_idx = pmap->port_index(pmap->handle, "control");
+ lv2_atom_forge_init(&handle->forge, handle->map);
+ handle->patch_Get = handle->map->map(handle->map->handle, LV2_PATCH__Get);
+ handle->patch_Set = handle->map->map(handle->map->handle, LV2_PATCH__Set);
+ handle->patch_Put = handle->map->map(handle->map->handle, LV2_PATCH__Put);
+ handle->patch_property = handle->map->map(handle->map->handle, LV2_PATCH__property);
+ handle->patch_value = handle->map->map(handle->map->handle, LV2_PATCH__value);
+ handle->patch_body = handle->map->map(handle->map->handle, LV2_PATCH__body);
+ handle->atom_eventTransfer= handle->map->map(handle->map->handle, LV2_ATOM__eventTransfer);
+ handle->view = puglInit(NULL, NULL);
+ if(!handle->view)
+ {
+ fprintf(stderr, "puglInit failed\n");
+ free(handle);
+ return NULL;
+ }
+ handle->w = 640;
+ handle->h = 640;;
+ puglInitWindowClass(handle->view, "canvas");
+ puglInitWindowParent(handle->view, (intptr_t)parent);
+ puglInitWindowSize(handle->view, handle->w, handle->h);
+ puglInitWindowMinSize(handle->view, handle->w/8, handle->h/8);
+ //puglInitWindowAspectRatio(handle->view, 1, 1, 1, 1);
+ puglInitResizable(handle->view, true);
+ puglInitTransientFor(handle->view, (intptr_t)parent);
+ puglSetHandle(handle->view, handle);
+ puglSetEventFunc(handle->view, _event_func);
+ puglInitContextType(handle->view, PUGL_GL);
+ const int stat = puglCreateWindow(handle->view, "CanvasGL");
+ if(stat != 0)
+ {
+ fprintf(stderr, "puglCreateWindow failed\n");
+ puglDestroy(handle->view);
+ free(handle);
+ return NULL;
+ }
+ puglShowWindow(handle->view);
+ puglEnterContext(handle->view);
+ glewExperimental = GL_TRUE;
+ const GLenum err = glewInit();
+ if(err != GLEW_OK)
+ {
+ fprintf(stderr, "glewInit failed: %s\n", glewGetErrorString(err));
+ free(handle);
+ return NULL;
+ }
+ if(!handle->ctx)
+ {
+ fprintf(stderr, "nvgCreate failed\n");
+ free(handle);
+ return NULL;
+ }
+ puglLeaveContext(handle->view, false);
+ const intptr_t child = puglGetNativeWindow(handle->view);
+ *(intptr_t *)widget = child;
+ if(handle->host_resize)
+ handle->host_resize->ui_resize(handle->host_resize->handle, handle->w, handle->h);
+ lv2_canvas_init(&handle->canvas, handle->map);
+ handle->controller = controller;
+ handle->writer = write_function;
+ _refresh(handle);
+ return handle;
+static void
+cleanup(LV2UI_Handle instance)
+ plughandle_t *handle = instance;
+ if(handle->graph)
+ {
+ free(handle->graph);
+ }
+ if(handle->ctx)
+ {
+ puglEnterContext(handle->view);
+ nvgDelete(handle->ctx);
+ puglLeaveContext(handle->view, false);
+ }
+ if(handle->view)
+ {
+ if(puglGetVisible(handle->view))
+ {
+ puglHideWindow(handle->view);
+ }
+ puglDestroy(handle->view);
+ }
+ free(handle);
+static void
+port_event(LV2UI_Handle instance, uint32_t index, uint32_t size,
+ uint32_t protocol, const void *buf)
+ plughandle_t *handle = instance;
+ if(protocol == handle->atom_eventTransfer) // notify
+ {
+ const LV2_Atom_Object *obj = buf;
+ if(lv2_atom_forge_is_object_type(&handle->forge, obj->atom.type))
+ {
+ if(obj->body.otype == handle->patch_Set)
+ {
+ const LV2_Atom_URID *property = NULL;
+ const LV2_Atom *value = NULL;
+ lv2_atom_object_get(obj,
+ handle->patch_property, &property,
+ handle->patch_value, &value,
+ 0);
+ if( property
+ && (property->atom.type == handle->forge.URID)
+ && (property->body == handle->canvas.urid.Canvas_graph)
+ && value
+ && (value->type == handle->forge.Tuple) )
+ {
+ if(handle->graph)
+ free(handle->graph);
+ const size_t sz = lv2_atom_total_size(value);
+ handle->graph = malloc(sz);
+ if(handle->graph)
+ memcpy(handle->graph, value, sz);
+ puglPostRedisplay(handle->view);
+ }
+ else if( property
+ && (property->atom.type == handle->forge.URID)
+ && (property->body == handle->canvas.urid.Canvas_aspectRatio)
+ && value
+ && (value->type == handle->forge.Float) )
+ {
+ handle->aspect_ratio = ((const LV2_Atom_Float *)value)->body;
+ int w;
+ int h;
+ puglGetSize(handle->view, &w, &h);
+ int W;
+ int H;
+ if(handle->aspect_ratio == 0.f)
+ {
+ W = w;
+ H = h;
+ }
+ else if(handle->aspect_ratio <= 1.f)
+ {
+ W = h * handle->aspect_ratio;
+ H = h;
+ }
+ else if(handle->aspect_ratio > 1.f)
+ {
+ W = w;
+ H = w / handle->aspect_ratio;
+ }
+ if(handle->host_resize && ( (W != w) || (H != h) ) )
+ handle->host_resize->ui_resize(handle->host_resize->handle, W, H);
+ puglPostRedisplay(handle->view);
+ }
+ }
+ }
+ }
+static int
+_idle(LV2UI_Handle instance)
+ plughandle_t *handle = instance;
+ puglProcessEvents(handle->view);
+ return handle->done;
+static const LV2UI_Idle_Interface idle_ext = {
+ .idle = _idle
+static const void *
+extension_data(const char *uri)
+ if(!strcmp(uri, LV2_UI__idleInterface))
+ return &idle_ext;
+ return NULL;
+const LV2UI_Descriptor canvas_canvas_ui = {
+ .URI = CANVAS_PREFIX"display_ui",
+ .instantiate = instantiate,
+ .cleanup = cleanup,
+ .port_event = port_event,
+ .extension_data = extension_data
+LV2_SYMBOL_EXPORT const LV2UI_Descriptor*
+lv2ui_descriptor(uint32_t index)
+ switch(index)
+ {
+ case 0:
+ return &canvas_canvas_ui;
+ default:
+ return NULL;
+ }
diff --git a/glew-2.1.0/GL/eglew.h b/glew-2.1.0/GL/eglew.h
new file mode 100644
index 0000000..4670147
--- /dev/null
+++ b/glew-2.1.0/GL/eglew.h
@@ -0,0 +1,2618 @@
+** The OpenGL Extension Wrangler Library
+** Copyright (C) 2008-2017, Nigel Stewart <nigels[]users sourceforge net>
+** Copyright (C) 2002-2008, Milan Ikits <milan ikits[]ieee org>
+** Copyright (C) 2002-2008, Marcelo E. Magallon <mmagallo[]debian org>
+** Copyright (C) 2002, Lev Povalahev
+** All rights reserved.
+** Redistribution and use in source and binary forms, with or without
+** modification, are permitted provided that the following conditions are met:
+** * Redistributions of source code must retain the above copyright notice,
+** this list of conditions and the following disclaimer.
+** * Redistributions in binary form must reproduce the above copyright notice,
+** this list of conditions and the following disclaimer in the documentation
+** and/or other materials provided with the distribution.
+** * The name of the author may be used to endorse or promote products
+** derived from this software without specific prior written permission.
+ * Mesa 3-D graphics library
+ * Version: 7.0
+ *
+ * Copyright (C) 1999-2007 Brian Paul All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the "Software"),
+ * to deal in the Software without restriction, including without limitation
+ * the rights to use, copy, modify, merge, publish, distribute, sublicense,
+ * and/or sell copies of the Software, and to permit persons to whom the
+ * Software is furnished to do so, subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included
+ * in all copies or substantial portions of the Software.
+ *
+ */
+** Copyright (c) 2007 The Khronos Group Inc.
+** Permission is hereby granted, free of charge, to any person obtaining a
+** copy of this software and/or associated documentation files (the
+** "Materials"), to deal in the Materials without restriction, including
+** without limitation the rights to use, copy, modify, merge, publish,
+** distribute, sublicense, and/or sell copies of the Materials, and to
+** permit persons to whom the Materials are furnished to do so, subject to
+** the following conditions:
+** The above copyright notice and this permission notice shall be included
+** in all copies or substantial portions of the Materials.
+#ifndef __eglew_h__
+#define __eglew_h__
+#define __EGLEW_H__
+#ifdef __eglext_h_
+#error eglext.h included before eglew.h
+#if defined(__egl_h_)
+#error egl.h included before eglew.h
+#define __eglext_h_
+#define __egl_h_
+#ifndef EGLAPI
+#define EGLAPI extern
+/* EGL Types */
+#include <sys/types.h>
+#include <KHR/khrplatform.h>
+#include <EGL/eglplatform.h>
+#include <GL/glew.h>
+#ifdef __cplusplus
+extern "C" {
+typedef int32_t EGLint;
+typedef unsigned int EGLBoolean;
+typedef void *EGLDisplay;
+typedef void *EGLConfig;
+typedef void *EGLSurface;
+typedef void *EGLContext;
+typedef void (*__eglMustCastToProperFunctionPointerType)(void);
+typedef unsigned int EGLenum;
+typedef void *EGLClientBuffer;
+typedef void *EGLSync;
+typedef intptr_t EGLAttrib;
+typedef khronos_utime_nanoseconds_t EGLTime;
+typedef void *EGLImage;
+typedef void *EGLSyncKHR;
+typedef intptr_t EGLAttribKHR;
+typedef void *EGLLabelKHR;
+typedef void *EGLObjectKHR;
+typedef void (EGLAPIENTRY *EGLDEBUGPROCKHR)(EGLenum error,const char *command,EGLint messageType,EGLLabelKHR threadLabel,EGLLabelKHR objectLabel,const char* message);
+typedef khronos_utime_nanoseconds_t EGLTimeKHR;
+typedef void *EGLImageKHR;
+typedef void *EGLStreamKHR;
+typedef khronos_uint64_t EGLuint64KHR;
+typedef int EGLNativeFileDescriptorKHR;
+typedef khronos_ssize_t EGLsizeiANDROID;
+typedef void (*EGLSetBlobFuncANDROID) (const void *key, EGLsizeiANDROID keySize, const void *value, EGLsizeiANDROID valueSize);
+typedef EGLsizeiANDROID (*EGLGetBlobFuncANDROID) (const void *key, EGLsizeiANDROID keySize, void *value, EGLsizeiANDROID valueSize);
+typedef void *EGLDeviceEXT;
+typedef void *EGLOutputLayerEXT;
+typedef void *EGLOutputPortEXT;
+typedef void *EGLSyncNV;
+typedef khronos_utime_nanoseconds_t EGLTimeNV;
+typedef khronos_utime_nanoseconds_t EGLuint64NV;
+typedef khronos_stime_nanoseconds_t EGLnsecsANDROID;
+struct EGLClientPixmapHI;
+#define EGL_DONT_CARE ((EGLint)-1)
+#define EGL_NO_CONTEXT ((EGLContext)0)
+#define EGL_NO_DISPLAY ((EGLDisplay)0)
+#define EGL_NO_IMAGE ((EGLImage)0)
+#define EGL_NO_SURFACE ((EGLSurface)0)
+#define EGL_NO_SYNC ((EGLSync)0)
+#define EGL_UNKNOWN ((EGLint)-1)
+#define EGL_DEFAULT_DISPLAY ((EGLNativeDisplayType)0)
+EGLAPI __eglMustCastToProperFunctionPointerType EGLAPIENTRY eglGetProcAddress (const char *procname);
+/* ---------------------------- EGL_VERSION_1_0 ---------------------------- */
+#ifndef EGL_VERSION_1_0
+#define EGL_VERSION_1_0 1
+#define EGL_FALSE 0
+#define EGL_PBUFFER_BIT 0x0001
+#define EGL_TRUE 1
+#define EGL_PIXMAP_BIT 0x0002
+#define EGL_WINDOW_BIT 0x0004
+#define EGL_SUCCESS 0x3000
+#define EGL_NOT_INITIALIZED 0x3001
+#define EGL_BAD_ACCESS 0x3002
+#define EGL_BAD_ALLOC 0x3003
+#define EGL_BAD_ATTRIBUTE 0x3004
+#define EGL_BAD_CONFIG 0x3005
+#define EGL_BAD_CONTEXT 0x3006
+#define EGL_BAD_DISPLAY 0x3008
+#define EGL_BAD_MATCH 0x3009
+#define EGL_BAD_PARAMETER 0x300C
+#define EGL_BAD_SURFACE 0x300D
+#define EGL_BUFFER_SIZE 0x3020
+#define EGL_ALPHA_SIZE 0x3021
+#define EGL_BLUE_SIZE 0x3022
+#define EGL_GREEN_SIZE 0x3023
+#define EGL_RED_SIZE 0x3024
+#define EGL_DEPTH_SIZE 0x3025
+#define EGL_STENCIL_SIZE 0x3026
+#define EGL_CONFIG_CAVEAT 0x3027
+#define EGL_CONFIG_ID 0x3028
+#define EGL_LEVEL 0x3029
+#define EGL_NATIVE_VISUAL_ID 0x302E
+#define EGL_SAMPLES 0x3031
+#define EGL_SAMPLE_BUFFERS 0x3032
+#define EGL_SURFACE_TYPE 0x3033
+#define EGL_TRANSPARENT_TYPE 0x3034
+#define EGL_NONE 0x3038
+#define EGL_SLOW_CONFIG 0x3050
+#define EGL_TRANSPARENT_RGB 0x3052
+#define EGL_VENDOR 0x3053
+#define EGL_VERSION 0x3054
+#define EGL_EXTENSIONS 0x3055
+#define EGL_HEIGHT 0x3056
+#define EGL_WIDTH 0x3057
+#define EGL_LARGEST_PBUFFER 0x3058
+#define EGL_DRAW 0x3059
+#define EGL_READ 0x305A
+typedef EGLBoolean ( * PFNEGLCHOOSECONFIGPROC) (EGLDisplay dpy, const EGLint * attrib_list, EGLConfig * configs, EGLint config_size, EGLint * num_config);
+typedef EGLBoolean ( * PFNEGLCOPYBUFFERSPROC) (EGLDisplay dpy, EGLSurface surface, EGLNativePixmapType target);
+typedef EGLContext ( * PFNEGLCREATECONTEXTPROC) (EGLDisplay dpy, EGLConfig config, EGLContext share_context, const EGLint * attrib_list);
+typedef EGLSurface ( * PFNEGLCREATEPBUFFERSURFACEPROC) (EGLDisplay dpy, EGLConfig config, const EGLint * attrib_list);
+typedef EGLSurface ( * PFNEGLCREATEPIXMAPSURFACEPROC) (EGLDisplay dpy, EGLConfig config, EGLNativePixmapType pixmap, const EGLint * attrib_list);
+typedef EGLSurface ( * PFNEGLCREATEWINDOWSURFACEPROC) (EGLDisplay dpy, EGLConfig config, EGLNativeWindowType win, const EGLint * attrib_list);
+typedef EGLBoolean ( * PFNEGLDESTROYCONTEXTPROC) (EGLDisplay dpy, EGLContext ctx);
+typedef EGLBoolean ( * PFNEGLDESTROYSURFACEPROC) (EGLDisplay dpy, EGLSurface surface);
+typedef EGLBoolean ( * PFNEGLGETCONFIGATTRIBPROC) (EGLDisplay dpy, EGLConfig config, EGLint attribute, EGLint * value);
+typedef EGLBoolean ( * PFNEGLGETCONFIGSPROC) (EGLDisplay dpy, EGLConfig * configs, EGLint config_size, EGLint * num_config);
+typedef EGLDisplay ( * PFNEGLGETCURRENTDISPLAYPROC) ( void );
+typedef EGLSurface ( * PFNEGLGETCURRENTSURFACEPROC) (EGLint readdraw);
+typedef EGLDisplay ( * PFNEGLGETDISPLAYPROC) (EGLNativeDisplayType display_id);
+typedef EGLint ( * PFNEGLGETERRORPROC) ( void );
+typedef EGLBoolean ( * PFNEGLINITIALIZEPROC) (EGLDisplay dpy, EGLint * major, EGLint * minor);
+typedef EGLBoolean ( * PFNEGLMAKECURRENTPROC) (EGLDisplay dpy, EGLSurface draw, EGLSurface read, EGLContext ctx);
+typedef EGLBoolean ( * PFNEGLQUERYCONTEXTPROC) (EGLDisplay dpy, EGLContext ctx, EGLint attribute, EGLint * value);
+typedef const char * ( * PFNEGLQUERYSTRINGPROC) (EGLDisplay dpy, EGLint name);
+typedef EGLBoolean ( * PFNEGLQUERYSURFACEPROC) (EGLDisplay dpy, EGLSurface surface, EGLint attribute, EGLint * value);
+typedef EGLBoolean ( * PFNEGLSWAPBUFFERSPROC) (EGLDisplay dpy, EGLSurface surface);
+typedef EGLBoolean ( * PFNEGLTERMINATEPROC) (EGLDisplay dpy);
+typedef EGLBoolean ( * PFNEGLWAITGLPROC) ( void );
+typedef EGLBoolean ( * PFNEGLWAITNATIVEPROC) (EGLint engine);
+#define eglChooseConfig EGLEW_GET_FUN(__eglewChooseConfig)
+#define eglCopyBuffers EGLEW_GET_FUN(__eglewCopyBuffers)
+#define eglCreateContext EGLEW_GET_FUN(__eglewCreateContext)
+#define eglCreatePbufferSurface EGLEW_GET_FUN(__eglewCreatePbufferSurface)
+#define eglCreatePixmapSurface EGLEW_GET_FUN(__eglewCreatePixmapSurface)
+#define eglCreateWindowSurface EGLEW_GET_FUN(__eglewCreateWindowSurface)
+#define eglDestroyContext EGLEW_GET_FUN(__eglewDestroyContext)
+#define eglDestroySurface EGLEW_GET_FUN(__eglewDestroySurface)
+#define eglGetConfigAttrib EGLEW_GET_FUN(__eglewGetConfigAttrib)
+#define eglGetConfigs EGLEW_GET_FUN(__eglewGetConfigs)
+#define eglGetCurrentDisplay EGLEW_GET_FUN(__eglewGetCurrentDisplay)
+#define eglGetCurrentSurface EGLEW_GET_FUN(__eglewGetCurrentSurface)
+#define eglGetDisplay EGLEW_GET_FUN(__eglewGetDisplay)
+#define eglGetError EGLEW_GET_FUN(__eglewGetError)
+#define eglInitialize EGLEW_GET_FUN(__eglewInitialize)
+#define eglMakeCurrent EGLEW_GET_FUN(__eglewMakeCurrent)
+#define eglQueryContext EGLEW_GET_FUN(__eglewQueryContext)
+#define eglQueryString EGLEW_GET_FUN(__eglewQueryString)
+#define eglQuerySurface EGLEW_GET_FUN(__eglewQuerySurface)
+#define eglSwapBuffers EGLEW_GET_FUN(__eglewSwapBuffers)
+#define eglTerminate EGLEW_GET_FUN(__eglewTerminate)
+#define eglWaitGL EGLEW_GET_FUN(__eglewWaitGL)
+#define eglWaitNative EGLEW_GET_FUN(__eglewWaitNative)
+#endif /* EGL_VERSION_1_0 */
+/* ---------------------------- EGL_VERSION_1_1 ---------------------------- */
+#ifndef EGL_VERSION_1_1
+#define EGL_VERSION_1_1 1
+#define EGL_CONTEXT_LOST 0x300E
+#define EGL_BIND_TO_TEXTURE_RGB 0x3039
+#define EGL_NO_TEXTURE 0x305C
+#define EGL_TEXTURE_RGB 0x305D
+#define EGL_TEXTURE_RGBA 0x305E
+#define EGL_TEXTURE_2D 0x305F
+#define EGL_TEXTURE_FORMAT 0x3080
+#define EGL_TEXTURE_TARGET 0x3081
+#define EGL_MIPMAP_TEXTURE 0x3082
+#define EGL_MIPMAP_LEVEL 0x3083
+#define EGL_BACK_BUFFER 0x3084
+typedef EGLBoolean ( * PFNEGLBINDTEXIMAGEPROC) (EGLDisplay dpy, EGLSurface surface, EGLint buffer);
+typedef EGLBoolean ( * PFNEGLRELEASETEXIMAGEPROC) (EGLDisplay dpy, EGLSurface surface, EGLint buffer);
+typedef EGLBoolean ( * PFNEGLSURFACEATTRIBPROC) (EGLDisplay dpy, EGLSurface surface, EGLint attribute, EGLint value);
+typedef EGLBoolean ( * PFNEGLSWAPINTERVALPROC) (EGLDisplay dpy, EGLint interval);
+#define eglBindTexImage EGLEW_GET_FUN(__eglewBindTexImage)
+#define eglReleaseTexImage EGLEW_GET_FUN(__eglewReleaseTexImage)
+#define eglSurfaceAttrib EGLEW_GET_FUN(__eglewSurfaceAttrib)
+#define eglSwapInterval EGLEW_GET_FUN(__eglewSwapInterval)
+#endif /* EGL_VERSION_1_1 */
+/* ---------------------------- EGL_VERSION_1_2 ---------------------------- */
+#ifndef EGL_VERSION_1_2
+#define EGL_VERSION_1_2 1
+#define EGL_OPENGL_ES_BIT 0x0001
+#define EGL_OPENVG_BIT 0x0002
+#define EGL_LUMINANCE_SIZE 0x303D
+#define EGL_ALPHA_MASK_SIZE 0x303E
+#define EGL_RENDERABLE_TYPE 0x3040
+#define EGL_SINGLE_BUFFER 0x3085
+#define EGL_RENDER_BUFFER 0x3086
+#define EGL_COLORSPACE 0x3087
+#define EGL_ALPHA_FORMAT 0x3088
+#define EGL_ALPHA_FORMAT_PRE 0x308C
+#define EGL_CLIENT_APIS 0x308D
+#define EGL_RGB_BUFFER 0x308E
+#define EGL_PIXEL_ASPECT_RATIO 0x3092
+#define EGL_SWAP_BEHAVIOR 0x3093
+#define EGL_BUFFER_PRESERVED 0x3094
+#define EGL_BUFFER_DESTROYED 0x3095
+#define EGL_OPENVG_IMAGE 0x3096
+#define EGL_OPENGL_ES_API 0x30A0
+#define EGL_OPENVG_API 0x30A1
+#define EGL_DISPLAY_SCALING 10000
+typedef EGLBoolean ( * PFNEGLBINDAPIPROC) (EGLenum api);
+typedef EGLSurface ( * PFNEGLCREATEPBUFFERFROMCLIENTBUFFERPROC) (EGLDisplay dpy, EGLenum buftype, EGLClientBuffer buffer, EGLConfig config, const EGLint * attrib_list);
+typedef EGLenum ( * PFNEGLQUERYAPIPROC) ( void );
+typedef EGLBoolean ( * PFNEGLRELEASETHREADPROC) ( void );
+typedef EGLBoolean ( * PFNEGLWAITCLIENTPROC) ( void );
+#define eglBindAPI EGLEW_GET_FUN(__eglewBindAPI)
+#define eglCreatePbufferFromClientBuffer EGLEW_GET_FUN(__eglewCreatePbufferFromClientBuffer)
+#define eglQueryAPI EGLEW_GET_FUN(__eglewQueryAPI)
+#define eglReleaseThread EGLEW_GET_FUN(__eglewReleaseThread)
+#define eglWaitClient EGLEW_GET_FUN(__eglewWaitClient)
+#endif /* EGL_VERSION_1_2 */
+/* ---------------------------- EGL_VERSION_1_3 ---------------------------- */
+#ifndef EGL_VERSION_1_3
+#define EGL_VERSION_1_3 1
+#define EGL_OPENGL_ES2_BIT 0x0004
+#define EGL_CONFORMANT 0x3042
+#define EGL_VG_COLORSPACE 0x3087
+#define EGL_VG_ALPHA_FORMAT 0x3088
+#endif /* EGL_VERSION_1_3 */
+/* ---------------------------- EGL_VERSION_1_4 ---------------------------- */
+#ifndef EGL_VERSION_1_4
+#define EGL_VERSION_1_4 1
+#define EGL_OPENGL_BIT 0x0008
+#define EGL_OPENGL_API 0x30A2
+typedef EGLContext ( * PFNEGLGETCURRENTCONTEXTPROC) ( void );
+#define eglGetCurrentContext EGLEW_GET_FUN(__eglewGetCurrentContext)
+#endif /* EGL_VERSION_1_4 */
+/* ---------------------------- EGL_VERSION_1_5 ---------------------------- */
+#ifndef EGL_VERSION_1_5
+#define EGL_VERSION_1_5 1
+#define EGL_OPENGL_ES3_BIT 0x00000040
+#define EGL_GL_COLORSPACE_SRGB 0x3089
+#define EGL_CL_EVENT_HANDLE 0x309C
+#define EGL_GL_COLORSPACE 0x309D
+#define EGL_GL_TEXTURE_2D 0x30B1
+#define EGL_GL_TEXTURE_3D 0x30B2
+#define EGL_SYNC_STATUS 0x30F1
+#define EGL_SIGNALED 0x30F2
+#define EGL_UNSIGNALED 0x30F3
+#define EGL_SYNC_TYPE 0x30F7
+#define EGL_SYNC_CONDITION 0x30F8
+#define EGL_SYNC_FENCE 0x30F9
+#define EGL_SYNC_CL_EVENT 0x30FE
+typedef EGLint ( * PFNEGLCLIENTWAITSYNCPROC) (EGLDisplay dpy, EGLSync sync, EGLint flags, EGLTime timeout);
+typedef EGLImage ( * PFNEGLCREATEIMAGEPROC) (EGLDisplay dpy, EGLContext ctx, EGLenum target, EGLClientBuffer buffer, const EGLAttrib * attrib_list);
+typedef EGLSurface ( * PFNEGLCREATEPLATFORMPIXMAPSURFACEPROC) (EGLDisplay dpy, EGLConfig config, void * native_pixmap, const EGLAttrib * attrib_list);
+typedef EGLSurface ( * PFNEGLCREATEPLATFORMWINDOWSURFACEPROC) (EGLDisplay dpy, EGLConfig config, void * native_window, const EGLAttrib * attrib_list);
+typedef EGLSync ( * PFNEGLCREATESYNCPROC) (EGLDisplay dpy, EGLenum type, const EGLAttrib * attrib_list);
+typedef EGLBoolean ( * PFNEGLDESTROYIMAGEPROC) (EGLDisplay dpy, EGLImage image);
+typedef EGLBoolean ( * PFNEGLDESTROYSYNCPROC) (EGLDisplay dpy, EGLSync sync);
+typedef EGLDisplay ( * PFNEGLGETPLATFORMDISPLAYPROC) (EGLenum platform, void * native_display, const EGLAttrib * attrib_list);
+typedef EGLBoolean ( * PFNEGLGETSYNCATTRIBPROC) (EGLDisplay dpy, EGLSync sync, EGLint attribute, EGLAttrib * value);
+typedef EGLBoolean ( * PFNEGLWAITSYNCPROC) (EGLDisplay dpy, EGLSync sync, EGLint flags);
+#define eglClientWaitSync EGLEW_GET_FUN(__eglewClientWaitSync)
+#define eglCreateImage EGLEW_GET_FUN(__eglewCreateImage)
+#define eglCreatePlatformPixmapSurface EGLEW_GET_FUN(__eglewCreatePlatformPixmapSurface)
+#define eglCreatePlatformWindowSurface EGLEW_GET_FUN(__eglewCreatePlatformWindowSurface)
+#define eglCreateSync EGLEW_GET_FUN(__eglewCreateSync)
+#define eglDestroyImage EGLEW_GET_FUN(__eglewDestroyImage)
+#define eglDestroySync EGLEW_GET_FUN(__eglewDestroySync)
+#define eglGetPlatformDisplay EGLEW_GET_FUN(__eglewGetPlatformDisplay)
+#define eglGetSyncAttrib EGLEW_GET_FUN(__eglewGetSyncAttrib)
+#define eglWaitSync EGLEW_GET_FUN(__eglewWaitSync)
+#endif /* EGL_VERSION_1_5 */
+/* ------------------------- EGL_ANDROID_blob_cache ------------------------ */
+#ifndef EGL_ANDROID_blob_cache
+#define EGL_ANDROID_blob_cache 1
+#define eglSetBlobCacheFuncsANDROID EGLEW_GET_FUN(__eglewSetBlobCacheFuncsANDROID)
+#define EGLEW_ANDROID_blob_cache EGLEW_GET_VAR(__EGLEW_ANDROID_blob_cache)
+#endif /* EGL_ANDROID_blob_cache */
+/* ---------------- EGL_ANDROID_create_native_client_buffer ---------------- */
+#ifndef EGL_ANDROID_create_native_client_buffer
+#define EGL_ANDROID_create_native_client_buffer 1
+typedef EGLClientBuffer ( * PFNEGLCREATENATIVECLIENTBUFFERANDROIDPROC) (const EGLint * attrib_list);
+#define eglCreateNativeClientBufferANDROID EGLEW_GET_FUN(__eglewCreateNativeClientBufferANDROID)
+#define EGLEW_ANDROID_create_native_client_buffer EGLEW_GET_VAR(__EGLEW_ANDROID_create_native_client_buffer)
+#endif /* EGL_ANDROID_create_native_client_buffer */
+/* --------------------- EGL_ANDROID_framebuffer_target -------------------- */
+#ifndef EGL_ANDROID_framebuffer_target
+#define EGL_ANDROID_framebuffer_target 1
+#define EGLEW_ANDROID_framebuffer_target EGLEW_GET_VAR(__EGLEW_ANDROID_framebuffer_target)
+#endif /* EGL_ANDROID_framebuffer_target */
+/* ----------------- EGL_ANDROID_front_buffer_auto_refresh ----------------- */
+#ifndef EGL_ANDROID_front_buffer_auto_refresh
+#define EGL_ANDROID_front_buffer_auto_refresh 1
+#define EGLEW_ANDROID_front_buffer_auto_refresh EGLEW_GET_VAR(__EGLEW_ANDROID_front_buffer_auto_refresh)
+#endif /* EGL_ANDROID_front_buffer_auto_refresh */
+/* -------------------- EGL_ANDROID_image_native_buffer -------------------- */
+#ifndef EGL_ANDROID_image_native_buffer
+#define EGL_ANDROID_image_native_buffer 1
+#define EGLEW_ANDROID_image_native_buffer EGLEW_GET_VAR(__EGLEW_ANDROID_image_native_buffer)
+#endif /* EGL_ANDROID_image_native_buffer */
+/* --------------------- EGL_ANDROID_native_fence_sync --------------------- */
+#ifndef EGL_ANDROID_native_fence_sync
+#define EGL_ANDROID_native_fence_sync 1
+#define eglDupNativeFenceFDANDROID EGLEW_GET_FUN(__eglewDupNativeFenceFDANDROID)
+#define EGLEW_ANDROID_native_fence_sync EGLEW_GET_VAR(__EGLEW_ANDROID_native_fence_sync)
+#endif /* EGL_ANDROID_native_fence_sync */
+/* --------------------- EGL_ANDROID_presentation_time --------------------- */
+#ifndef EGL_ANDROID_presentation_time
+#define EGL_ANDROID_presentation_time 1
+typedef EGLBoolean ( * PFNEGLPRESENTATIONTIMEANDROIDPROC) (EGLDisplay dpy, EGLSurface surface, EGLnsecsANDROID time);
+#define eglPresentationTimeANDROID EGLEW_GET_FUN(__eglewPresentationTimeANDROID)
+#define EGLEW_ANDROID_presentation_time EGLEW_GET_VAR(__EGLEW_ANDROID_presentation_time)
+#endif /* EGL_ANDROID_presentation_time */
+/* ------------------------- EGL_ANDROID_recordable ------------------------ */
+#ifndef EGL_ANDROID_recordable
+#define EGL_ANDROID_recordable 1
+#define EGLEW_ANDROID_recordable EGLEW_GET_VAR(__EGLEW_ANDROID_recordable)
+#endif /* EGL_ANDROID_recordable */
+/* ---------------- EGL_ANGLE_d3d_share_handle_client_buffer --------------- */
+#ifndef EGL_ANGLE_d3d_share_handle_client_buffer
+#define EGL_ANGLE_d3d_share_handle_client_buffer 1
+#define EGLEW_ANGLE_d3d_share_handle_client_buffer EGLEW_GET_VAR(__EGLEW_ANGLE_d3d_share_handle_client_buffer)
+#endif /* EGL_ANGLE_d3d_share_handle_client_buffer */
+/* -------------------------- EGL_ANGLE_device_d3d ------------------------- */
+#ifndef EGL_ANGLE_device_d3d
+#define EGL_ANGLE_device_d3d 1
+#define EGL_D3D9_DEVICE_ANGLE 0x33A0
+#define EGL_D3D11_DEVICE_ANGLE 0x33A1
+#define EGLEW_ANGLE_device_d3d EGLEW_GET_VAR(__EGLEW_ANGLE_device_d3d)
+#endif /* EGL_ANGLE_device_d3d */
+/* -------------------- EGL_ANGLE_query_surface_pointer -------------------- */
+#ifndef EGL_ANGLE_query_surface_pointer
+#define EGL_ANGLE_query_surface_pointer 1
+typedef EGLBoolean ( * PFNEGLQUERYSURFACEPOINTERANGLEPROC) (EGLDisplay dpy, EGLSurface surface, EGLint attribute, void ** value);
+#define eglQuerySurfacePointerANGLE EGLEW_GET_FUN(__eglewQuerySurfacePointerANGLE)
+#define EGLEW_ANGLE_query_surface_pointer EGLEW_GET_VAR(__EGLEW_ANGLE_query_surface_pointer)
+#endif /* EGL_ANGLE_query_surface_pointer */
+/* ------------- EGL_ANGLE_surface_d3d_texture_2d_share_handle ------------- */
+#ifndef EGL_ANGLE_surface_d3d_texture_2d_share_handle
+#define EGL_ANGLE_surface_d3d_texture_2d_share_handle 1
+#define EGLEW_ANGLE_surface_d3d_texture_2d_share_handle EGLEW_GET_VAR(__EGLEW_ANGLE_surface_d3d_texture_2d_share_handle)
+#endif /* EGL_ANGLE_surface_d3d_texture_2d_share_handle */
+/* ---------------------- EGL_ANGLE_window_fixed_size ---------------------- */
+#ifndef EGL_ANGLE_window_fixed_size
+#define EGL_ANGLE_window_fixed_size 1
+#define EGL_FIXED_SIZE_ANGLE 0x3201
+#define EGLEW_ANGLE_window_fixed_size EGLEW_GET_VAR(__EGLEW_ANGLE_window_fixed_size)
+#endif /* EGL_ANGLE_window_fixed_size */
+/* --------------------- EGL_ARM_implicit_external_sync -------------------- */
+#ifndef EGL_ARM_implicit_external_sync
+#define EGL_ARM_implicit_external_sync 1
+#define EGLEW_ARM_implicit_external_sync EGLEW_GET_VAR(__EGLEW_ARM_implicit_external_sync)
+#endif /* EGL_ARM_implicit_external_sync */
+/* ------------------- EGL_ARM_pixmap_multisample_discard ------------------ */
+#ifndef EGL_ARM_pixmap_multisample_discard
+#define EGL_ARM_pixmap_multisample_discard 1
+#define EGLEW_ARM_pixmap_multisample_discard EGLEW_GET_VAR(__EGLEW_ARM_pixmap_multisample_discard)
+#endif /* EGL_ARM_pixmap_multisample_discard */
+/* --------------------------- EGL_EXT_buffer_age -------------------------- */
+#ifndef EGL_EXT_buffer_age
+#define EGL_EXT_buffer_age 1
+#define EGL_BUFFER_AGE_EXT 0x313D
+#define EGLEW_EXT_buffer_age EGLEW_GET_VAR(__EGLEW_EXT_buffer_age)
+#endif /* EGL_EXT_buffer_age */
+/* ----------------------- EGL_EXT_client_extensions ----------------------- */
+#ifndef EGL_EXT_client_extensions
+#define EGL_EXT_client_extensions 1
+#define EGLEW_EXT_client_extensions EGLEW_GET_VAR(__EGLEW_EXT_client_extensions)
+#endif /* EGL_EXT_client_extensions */
+/* ------------------- EGL_EXT_create_context_robustness ------------------- */
+#ifndef EGL_EXT_create_context_robustness
+#define EGL_EXT_create_context_robustness 1
+#define EGLEW_EXT_create_context_robustness EGLEW_GET_VAR(__EGLEW_EXT_create_context_robustness)
+#endif /* EGL_EXT_create_context_robustness */
+/* -------------------------- EGL_EXT_device_base -------------------------- */
+#ifndef EGL_EXT_device_base
+#define EGL_EXT_device_base 1
+#define EGL_BAD_DEVICE_EXT 0x322B
+#define EGL_DEVICE_EXT 0x322C
+#define EGLEW_EXT_device_base EGLEW_GET_VAR(__EGLEW_EXT_device_base)
+#endif /* EGL_EXT_device_base */
+/* --------------------------- EGL_EXT_device_drm -------------------------- */
+#ifndef EGL_EXT_device_drm
+#define EGL_EXT_device_drm 1
+#define EGL_DRM_DEVICE_FILE_EXT 0x3233
+#define EGLEW_EXT_device_drm EGLEW_GET_VAR(__EGLEW_EXT_device_drm)
+#endif /* EGL_EXT_device_drm */
+/* ----------------------- EGL_EXT_device_enumeration ---------------------- */
+#ifndef EGL_EXT_device_enumeration
+#define EGL_EXT_device_enumeration 1
+typedef EGLBoolean ( * PFNEGLQUERYDEVICESEXTPROC) (EGLint max_devices, EGLDeviceEXT * devices, EGLint * num_devices);
+#define eglQueryDevicesEXT EGLEW_GET_FUN(__eglewQueryDevicesEXT)
+#define EGLEW_EXT_device_enumeration EGLEW_GET_VAR(__EGLEW_EXT_device_enumeration)
+#endif /* EGL_EXT_device_enumeration */
+/* ------------------------- EGL_EXT_device_openwf ------------------------- */
+#ifndef EGL_EXT_device_openwf
+#define EGL_EXT_device_openwf 1
+#define EGL_OPENWF_DEVICE_ID_EXT 0x3237
+#define EGLEW_EXT_device_openwf EGLEW_GET_VAR(__EGLEW_EXT_device_openwf)
+#endif /* EGL_EXT_device_openwf */
+/* -------------------------- EGL_EXT_device_query ------------------------- */
+#ifndef EGL_EXT_device_query
+#define EGL_EXT_device_query 1
+#define EGL_BAD_DEVICE_EXT 0x322B
+#define EGL_DEVICE_EXT 0x322C
+typedef EGLBoolean ( * PFNEGLQUERYDEVICEATTRIBEXTPROC) (EGLDeviceEXT device, EGLint attribute, EGLAttrib * value);
+typedef const char * ( * PFNEGLQUERYDEVICESTRINGEXTPROC) (EGLDeviceEXT device, EGLint name);
+typedef EGLBoolean ( * PFNEGLQUERYDISPLAYATTRIBEXTPROC) (EGLDisplay dpy, EGLint attribute, EGLAttrib * value);
+#define eglQueryDeviceAttribEXT EGLEW_GET_FUN(__eglewQueryDeviceAttribEXT)
+#define eglQueryDeviceStringEXT EGLEW_GET_FUN(__eglewQueryDeviceStringEXT)
+#define eglQueryDisplayAttribEXT EGLEW_GET_FUN(__eglewQueryDisplayAttribEXT)
+#define EGLEW_EXT_device_query EGLEW_GET_VAR(__EGLEW_EXT_device_query)
+#endif /* EGL_EXT_device_query */
+/* ------------------ EGL_EXT_gl_colorspace_bt2020_linear ------------------ */
+#ifndef EGL_EXT_gl_colorspace_bt2020_linear
+#define EGL_EXT_gl_colorspace_bt2020_linear 1
+#define EGLEW_EXT_gl_colorspace_bt2020_linear EGLEW_GET_VAR(__EGLEW_EXT_gl_colorspace_bt2020_linear)
+#endif /* EGL_EXT_gl_colorspace_bt2020_linear */
+/* -------------------- EGL_EXT_gl_colorspace_bt2020_pq -------------------- */
+#ifndef EGL_EXT_gl_colorspace_bt2020_pq
+#define EGL_EXT_gl_colorspace_bt2020_pq 1
+#define EGL_GL_COLORSPACE_BT2020_PQ_EXT 0x3340
+#define EGLEW_EXT_gl_colorspace_bt2020_pq EGLEW_GET_VAR(__EGLEW_EXT_gl_colorspace_bt2020_pq)
+#endif /* EGL_EXT_gl_colorspace_bt2020_pq */
+/* ------------------- EGL_EXT_gl_colorspace_scrgb_linear ------------------ */
+#ifndef EGL_EXT_gl_colorspace_scrgb_linear
+#define EGL_EXT_gl_colorspace_scrgb_linear 1
+#define EGLEW_EXT_gl_colorspace_scrgb_linear EGLEW_GET_VAR(__EGLEW_EXT_gl_colorspace_scrgb_linear)
+#endif /* EGL_EXT_gl_colorspace_scrgb_linear */
+/* ---------------------- EGL_EXT_image_dma_buf_import --------------------- */
+#ifndef EGL_EXT_image_dma_buf_import
+#define EGL_EXT_image_dma_buf_import 1
+#define EGL_LINUX_DMA_BUF_EXT 0x3270
+#define EGL_LINUX_DRM_FOURCC_EXT 0x3271
+#define EGL_DMA_BUF_PLANE0_FD_EXT 0x3272
+#define EGL_DMA_BUF_PLANE0_PITCH_EXT 0x3274
+#define EGL_DMA_BUF_PLANE1_FD_EXT 0x3275
+#define EGL_DMA_BUF_PLANE1_PITCH_EXT 0x3277
+#define EGL_DMA_BUF_PLANE2_FD_EXT 0x3278
+#define EGL_ITU_REC601_EXT 0x327F
+#define EGL_ITU_REC709_EXT 0x3280
+#define EGL_ITU_REC2020_EXT 0x3281
+#define EGL_YUV_FULL_RANGE_EXT 0x3282
+#define EGL_YUV_NARROW_RANGE_EXT 0x3283
+#define EGL_YUV_CHROMA_SITING_0_EXT 0x3284
+#define EGL_YUV_CHROMA_SITING_0_5_EXT 0x3285
+#define EGLEW_EXT_image_dma_buf_import EGLEW_GET_VAR(__EGLEW_EXT_image_dma_buf_import)
+#endif /* EGL_EXT_image_dma_buf_import */
+/* ----------------- EGL_EXT_image_dma_buf_import_modifiers ---------------- */
+#ifndef EGL_EXT_image_dma_buf_import_modifiers
+#define EGL_EXT_image_dma_buf_import_modifiers 1
+#define EGL_DMA_BUF_PLANE3_FD_EXT 0x3440
+#define EGL_DMA_BUF_PLANE3_PITCH_EXT 0x3442
+typedef EGLBoolean ( * PFNEGLQUERYDMABUFFORMATSEXTPROC) (EGLDisplay dpy, EGLint max_formats, EGLint *formats, EGLint *num_formats);
+typedef EGLBoolean ( * PFNEGLQUERYDMABUFMODIFIERSEXTPROC) (EGLDisplay dpy, EGLint format, EGLint max_modifiers, EGLuint64KHR *modifiers, EGLBoolean *external_only, EGLint *num_modifiers);
+#define eglQueryDmaBufFormatsEXT EGLEW_GET_FUN(__eglewQueryDmaBufFormatsEXT)
+#define eglQueryDmaBufModifiersEXT EGLEW_GET_FUN(__eglewQueryDmaBufModifiersEXT)
+#define EGLEW_EXT_image_dma_buf_import_modifiers EGLEW_GET_VAR(__EGLEW_EXT_image_dma_buf_import_modifiers)
+#endif /* EGL_EXT_image_dma_buf_import_modifiers */
+/* ------------------------ EGL_EXT_multiview_window ----------------------- */
+#ifndef EGL_EXT_multiview_window
+#define EGL_EXT_multiview_window 1
+#define EGLEW_EXT_multiview_window EGLEW_GET_VAR(__EGLEW_EXT_multiview_window)
+#endif /* EGL_EXT_multiview_window */
+/* -------------------------- EGL_EXT_output_base -------------------------- */
+#ifndef EGL_EXT_output_base
+#define EGL_EXT_output_base 1
+typedef EGLBoolean ( * PFNEGLGETOUTPUTLAYERSEXTPROC) (EGLDisplay dpy, const EGLAttrib * attrib_list, EGLOutputLayerEXT * layers, EGLint max_layers, EGLint * num_layers);
+typedef EGLBoolean ( * PFNEGLGETOUTPUTPORTSEXTPROC) (EGLDisplay dpy, const EGLAttrib * attrib_list, EGLOutputPortEXT * ports, EGLint max_ports, EGLint * num_ports);
+typedef EGLBoolean ( * PFNEGLOUTPUTLAYERATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint attribute, EGLAttrib value);
+typedef EGLBoolean ( * PFNEGLOUTPUTPORTATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputPortEXT port, EGLint attribute, EGLAttrib value);
+typedef EGLBoolean ( * PFNEGLQUERYOUTPUTLAYERATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint attribute, EGLAttrib * value);
+typedef const char * ( * PFNEGLQUERYOUTPUTLAYERSTRINGEXTPROC) (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint name);
+typedef EGLBoolean ( * PFNEGLQUERYOUTPUTPORTATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputPortEXT port, EGLint attribute, EGLAttrib * value);
+typedef const char * ( * PFNEGLQUERYOUTPUTPORTSTRINGEXTPROC) (EGLDisplay dpy, EGLOutputPortEXT port, EGLint name);
+#define eglGetOutputLayersEXT EGLEW_GET_FUN(__eglewGetOutputLayersEXT)
+#define eglGetOutputPortsEXT EGLEW_GET_FUN(__eglewGetOutputPortsEXT)
+#define eglOutputLayerAttribEXT EGLEW_GET_FUN(__eglewOutputLayerAttribEXT)
+#define eglOutputPortAttribEXT EGLEW_GET_FUN(__eglewOutputPortAttribEXT)
+#define eglQueryOutputLayerAttribEXT EGLEW_GET_FUN(__eglewQueryOutputLayerAttribEXT)
+#define eglQueryOutputLayerStringEXT EGLEW_GET_FUN(__eglewQueryOutputLayerStringEXT)
+#define eglQueryOutputPortAttribEXT EGLEW_GET_FUN(__eglewQueryOutputPortAttribEXT)
+#define eglQueryOutputPortStringEXT EGLEW_GET_FUN(__eglewQueryOutputPortStringEXT)
+#define EGLEW_EXT_output_base EGLEW_GET_VAR(__EGLEW_EXT_output_base)
+#endif /* EGL_EXT_output_base */
+/* --------------------------- EGL_EXT_output_drm -------------------------- */
+#ifndef EGL_EXT_output_drm
+#define EGL_EXT_output_drm 1
+#define EGL_DRM_CRTC_EXT 0x3234
+#define EGL_DRM_PLANE_EXT 0x3235
+#define EGL_DRM_CONNECTOR_EXT 0x3236
+#define EGLEW_EXT_output_drm EGLEW_GET_VAR(__EGLEW_EXT_output_drm)
+#endif /* EGL_EXT_output_drm */
+/* ------------------------- EGL_EXT_output_openwf ------------------------- */
+#ifndef EGL_EXT_output_openwf
+#define EGL_EXT_output_openwf 1
+#define EGL_OPENWF_PORT_ID_EXT 0x3239
+#define EGLEW_EXT_output_openwf EGLEW_GET_VAR(__EGLEW_EXT_output_openwf)
+#endif /* EGL_EXT_output_openwf */
+/* ----------------------- EGL_EXT_pixel_format_float ---------------------- */
+#ifndef EGL_EXT_pixel_format_float
+#define EGL_EXT_pixel_format_float 1
+#define EGLEW_EXT_pixel_format_float EGLEW_GET_VAR(__EGLEW_EXT_pixel_format_float)
+#endif /* EGL_EXT_pixel_format_float */
+/* ------------------------- EGL_EXT_platform_base ------------------------- */
+#ifndef EGL_EXT_platform_base
+#define EGL_EXT_platform_base 1
+typedef EGLSurface ( * PFNEGLCREATEPLATFORMPIXMAPSURFACEEXTPROC) (EGLDisplay dpy, EGLConfig config, void * native_pixmap, const EGLint * attrib_list);
+typedef EGLSurface ( * PFNEGLCREATEPLATFORMWINDOWSURFACEEXTPROC) (EGLDisplay dpy, EGLConfig config, void * native_window, const EGLint * attrib_list);
+typedef EGLDisplay ( * PFNEGLGETPLATFORMDISPLAYEXTPROC) (EGLenum platform, void * native_display, const EGLint * attrib_list);
+#define eglCreatePlatformPixmapSurfaceEXT EGLEW_GET_FUN(__eglewCreatePlatformPixmapSurfaceEXT)
+#define eglCreatePlatformWindowSurfaceEXT EGLEW_GET_FUN(__eglewCreatePlatformWindowSurfaceEXT)
+#define eglGetPlatformDisplayEXT EGLEW_GET_FUN(__eglewGetPlatformDisplayEXT)
+#define EGLEW_EXT_platform_base EGLEW_GET_VAR(__EGLEW_EXT_platform_base)
+#endif /* EGL_EXT_platform_base */
+/* ------------------------ EGL_EXT_platform_device ------------------------ */
+#ifndef EGL_EXT_platform_device
+#define EGL_EXT_platform_device 1
+#define EGLEW_EXT_platform_device EGLEW_GET_VAR(__EGLEW_EXT_platform_device)
+#endif /* EGL_EXT_platform_device */
+/* ------------------------ EGL_EXT_platform_wayland ----------------------- */
+#ifndef EGL_EXT_platform_wayland
+#define EGL_EXT_platform_wayland 1
+#define EGLEW_EXT_platform_wayland EGLEW_GET_VAR(__EGLEW_EXT_platform_wayland)
+#endif /* EGL_EXT_platform_wayland */
+/* -------------------------- EGL_EXT_platform_x11 ------------------------- */
+#ifndef EGL_EXT_platform_x11
+#define EGL_EXT_platform_x11 1
+#define EGL_PLATFORM_X11_EXT 0x31D5
+#define EGLEW_EXT_platform_x11 EGLEW_GET_VAR(__EGLEW_EXT_platform_x11)
+#endif /* EGL_EXT_platform_x11 */
+/* ----------------------- EGL_EXT_protected_content ----------------------- */
+#ifndef EGL_EXT_protected_content
+#define EGL_EXT_protected_content 1
+#define EGLEW_EXT_protected_content EGLEW_GET_VAR(__EGLEW_EXT_protected_content)
+#endif /* EGL_EXT_protected_content */
+/* ----------------------- EGL_EXT_protected_surface ----------------------- */
+#ifndef EGL_EXT_protected_surface
+#define EGL_EXT_protected_surface 1
+#define EGLEW_EXT_protected_surface EGLEW_GET_VAR(__EGLEW_EXT_protected_surface)
+#endif /* EGL_EXT_protected_surface */
+/* ------------------- EGL_EXT_stream_consumer_egloutput ------------------- */
+#ifndef EGL_EXT_stream_consumer_egloutput
+#define EGL_EXT_stream_consumer_egloutput 1
+typedef EGLBoolean ( * PFNEGLSTREAMCONSUMEROUTPUTEXTPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLOutputLayerEXT layer);
+#define eglStreamConsumerOutputEXT EGLEW_GET_FUN(__eglewStreamConsumerOutputEXT)
+#define EGLEW_EXT_stream_consumer_egloutput EGLEW_GET_VAR(__EGLEW_EXT_stream_consumer_egloutput)
+#endif /* EGL_EXT_stream_consumer_egloutput */
+/* ------------------- EGL_EXT_surface_SMPTE2086_metadata ------------------ */
+#ifndef EGL_EXT_surface_SMPTE2086_metadata
+#define EGL_EXT_surface_SMPTE2086_metadata 1
+#define EGL_SMPTE2086_WHITE_POINT_X_EXT 0x3347
+#define EGL_SMPTE2086_WHITE_POINT_Y_EXT 0x3348
+#define EGL_SMPTE2086_MAX_LUMINANCE_EXT 0x3349
+#define EGLEW_EXT_surface_SMPTE2086_metadata EGLEW_GET_VAR(__EGLEW_EXT_surface_SMPTE2086_metadata)
+#endif /* EGL_EXT_surface_SMPTE2086_metadata */
+/* -------------------- EGL_EXT_swap_buffers_with_damage ------------------- */
+#ifndef EGL_EXT_swap_buffers_with_damage
+#define EGL_EXT_swap_buffers_with_damage 1
+typedef EGLBoolean ( * PFNEGLSWAPBUFFERSWITHDAMAGEEXTPROC) (EGLDisplay dpy, EGLSurface surface, EGLint * rects, EGLint n_rects);
+#define eglSwapBuffersWithDamageEXT EGLEW_GET_FUN(__eglewSwapBuffersWithDamageEXT)
+#define EGLEW_EXT_swap_buffers_with_damage EGLEW_GET_VAR(__EGLEW_EXT_swap_buffers_with_damage)
+#endif /* EGL_EXT_swap_buffers_with_damage */
+/* -------------------------- EGL_EXT_yuv_surface -------------------------- */
+#ifndef EGL_EXT_yuv_surface
+#define EGL_EXT_yuv_surface 1
+#define EGL_YUV_BUFFER_EXT 0x3300
+#define EGL_YUV_ORDER_EXT 0x3301
+#define EGL_YUV_ORDER_YUV_EXT 0x3302
+#define EGL_YUV_ORDER_YVU_EXT 0x3303
+#define EGL_YUV_ORDER_YUYV_EXT 0x3304
+#define EGL_YUV_ORDER_UYVY_EXT 0x3305
+#define EGL_YUV_ORDER_YVYU_EXT 0x3306
+#define EGL_YUV_ORDER_VYUY_EXT 0x3307
+#define EGL_YUV_ORDER_AYUV_EXT 0x3308
+#define EGL_YUV_CSC_STANDARD_601_EXT 0x330B
+#define EGL_YUV_CSC_STANDARD_709_EXT 0x330C
+#define EGL_YUV_CSC_STANDARD_2020_EXT 0x330D
+#define EGL_YUV_SUBSAMPLE_EXT 0x3312
+#define EGL_YUV_SUBSAMPLE_4_2_0_EXT 0x3313
+#define EGL_YUV_SUBSAMPLE_4_2_2_EXT 0x3314
+#define EGL_YUV_SUBSAMPLE_4_4_4_EXT 0x3315
+#define EGL_YUV_DEPTH_RANGE_EXT 0x3317
+#define EGL_YUV_PLANE_BPP_EXT 0x331A
+#define EGL_YUV_PLANE_BPP_0_EXT 0x331B
+#define EGL_YUV_PLANE_BPP_8_EXT 0x331C
+#define EGL_YUV_PLANE_BPP_10_EXT 0x331D
+#define EGLEW_EXT_yuv_surface EGLEW_GET_VAR(__EGLEW_EXT_yuv_surface)
+#endif /* EGL_EXT_yuv_surface */
+/* -------------------------- EGL_HI_clientpixmap -------------------------- */
+#ifndef EGL_HI_clientpixmap
+#define EGL_HI_clientpixmap 1
+typedef EGLSurface ( * PFNEGLCREATEPIXMAPSURFACEHIPROC) (EGLDisplay dpy, EGLConfig config, struct EGLClientPixmapHI * pixmap);
+#define eglCreatePixmapSurfaceHI EGLEW_GET_FUN(__eglewCreatePixmapSurfaceHI)
+#define EGLEW_HI_clientpixmap EGLEW_GET_VAR(__EGLEW_HI_clientpixmap)
+#endif /* EGL_HI_clientpixmap */
+/* -------------------------- EGL_HI_colorformats -------------------------- */
+#ifndef EGL_HI_colorformats
+#define EGL_HI_colorformats 1
+#define EGL_COLOR_FORMAT_HI 0x8F70
+#define EGL_COLOR_RGB_HI 0x8F71
+#define EGL_COLOR_RGBA_HI 0x8F72
+#define EGL_COLOR_ARGB_HI 0x8F73
+#define EGLEW_HI_colorformats EGLEW_GET_VAR(__EGLEW_HI_colorformats)
+#endif /* EGL_HI_colorformats */
+/* ------------------------ EGL_IMG_context_priority ----------------------- */
+#ifndef EGL_IMG_context_priority
+#define EGL_IMG_context_priority 1
+#define EGLEW_IMG_context_priority EGLEW_GET_VAR(__EGLEW_IMG_context_priority)
+#endif /* EGL_IMG_context_priority */
+/* ---------------------- EGL_IMG_image_plane_attribs ---------------------- */
+#ifndef EGL_IMG_image_plane_attribs
+#define EGL_IMG_image_plane_attribs 1
+#define EGLEW_IMG_image_plane_attribs EGLEW_GET_VAR(__EGLEW_IMG_image_plane_attribs)
+#endif /* EGL_IMG_image_plane_attribs */
+/* ---------------------------- EGL_KHR_cl_event --------------------------- */
+#ifndef EGL_KHR_cl_event
+#define EGL_KHR_cl_event 1
+#define EGLEW_KHR_cl_event EGLEW_GET_VAR(__EGLEW_KHR_cl_event)
+#endif /* EGL_KHR_cl_event */
+/* --------------------------- EGL_KHR_cl_event2 --------------------------- */
+#ifndef EGL_KHR_cl_event2
+#define EGL_KHR_cl_event2 1
+typedef EGLSyncKHR ( * PFNEGLCREATESYNC64KHRPROC) (EGLDisplay dpy, EGLenum type, const EGLAttribKHR * attrib_list);
+#define eglCreateSync64KHR EGLEW_GET_FUN(__eglewCreateSync64KHR)
+#define EGLEW_KHR_cl_event2 EGLEW_GET_VAR(__EGLEW_KHR_cl_event2)
+#endif /* EGL_KHR_cl_event2 */
+/* ----------------- EGL_KHR_client_get_all_proc_addresses ----------------- */
+#ifndef EGL_KHR_client_get_all_proc_addresses
+#define EGL_KHR_client_get_all_proc_addresses 1
+#define EGLEW_KHR_client_get_all_proc_addresses EGLEW_GET_VAR(__EGLEW_KHR_client_get_all_proc_addresses)
+#endif /* EGL_KHR_client_get_all_proc_addresses */
+/* ------------------------- EGL_KHR_config_attribs ------------------------ */
+#ifndef EGL_KHR_config_attribs
+#define EGL_KHR_config_attribs 1
+#define EGL_CONFORMANT_KHR 0x3042
+#define EGLEW_KHR_config_attribs EGLEW_GET_VAR(__EGLEW_KHR_config_attribs)
+#endif /* EGL_KHR_config_attribs */
+/* --------------------- EGL_KHR_context_flush_control --------------------- */
+#ifndef EGL_KHR_context_flush_control
+#define EGL_KHR_context_flush_control 1
+#define EGLEW_KHR_context_flush_control EGLEW_GET_VAR(__EGLEW_KHR_context_flush_control)
+#endif /* EGL_KHR_context_flush_control */
+/* ------------------------- EGL_KHR_create_context ------------------------ */
+#ifndef EGL_KHR_create_context
+#define EGL_KHR_create_context 1
+#define EGL_OPENGL_ES3_BIT 0x00000040
+#define EGL_OPENGL_ES3_BIT_KHR 0x00000040
+#define EGLEW_KHR_create_context EGLEW_GET_VAR(__EGLEW_KHR_create_context)
+#endif /* EGL_KHR_create_context */
+/* -------------------- EGL_KHR_create_context_no_error -------------------- */
+#ifndef EGL_KHR_create_context_no_error
+#define EGL_KHR_create_context_no_error 1
+#define EGLEW_KHR_create_context_no_error EGLEW_GET_VAR(__EGLEW_KHR_create_context_no_error)
+#endif /* EGL_KHR_create_context_no_error */
+/* ----------------------------- EGL_KHR_debug ----------------------------- */
+#ifndef EGL_KHR_debug
+#define EGL_KHR_debug 1
+#define EGL_OBJECT_IMAGE_KHR 0x33B4
+#define EGL_OBJECT_SYNC_KHR 0x33B5
+typedef EGLint ( * PFNEGLDEBUGMESSAGECONTROLKHRPROC) (EGLDEBUGPROCKHR callback, const EGLAttrib * attrib_list);
+typedef EGLint ( * PFNEGLLABELOBJECTKHRPROC) (EGLDisplay display, EGLenum objectType, EGLObjectKHR object, EGLLabelKHR label);
+typedef EGLBoolean ( * PFNEGLQUERYDEBUGKHRPROC) (EGLint attribute, EGLAttrib * value);
+#define eglDebugMessageControlKHR EGLEW_GET_FUN(__eglewDebugMessageControlKHR)
+#define eglLabelObjectKHR EGLEW_GET_FUN(__eglewLabelObjectKHR)
+#define eglQueryDebugKHR EGLEW_GET_FUN(__eglewQueryDebugKHR)
+#define EGLEW_KHR_debug EGLEW_GET_VAR(__EGLEW_KHR_debug)
+#endif /* EGL_KHR_debug */
+/* --------------------------- EGL_KHR_fence_sync -------------------------- */
+#ifndef EGL_KHR_fence_sync
+#define EGL_KHR_fence_sync 1
+#define EGL_SYNC_FENCE_KHR 0x30F9
+#define EGLEW_KHR_fence_sync EGLEW_GET_VAR(__EGLEW_KHR_fence_sync)
+#endif /* EGL_KHR_fence_sync */
+/* --------------------- EGL_KHR_get_all_proc_addresses -------------------- */
+#ifndef EGL_KHR_get_all_proc_addresses
+#define EGL_KHR_get_all_proc_addresses 1
+#define EGLEW_KHR_get_all_proc_addresses EGLEW_GET_VAR(__EGLEW_KHR_get_all_proc_addresses)
+#endif /* EGL_KHR_get_all_proc_addresses */
+/* ------------------------- EGL_KHR_gl_colorspace ------------------------- */
+#ifndef EGL_KHR_gl_colorspace
+#define EGL_KHR_gl_colorspace 1
+#define EGLEW_KHR_gl_colorspace EGLEW_GET_VAR(__EGLEW_KHR_gl_colorspace)
+#endif /* EGL_KHR_gl_colorspace */
+/* --------------------- EGL_KHR_gl_renderbuffer_image --------------------- */
+#ifndef EGL_KHR_gl_renderbuffer_image
+#define EGL_KHR_gl_renderbuffer_image 1
+#define EGLEW_KHR_gl_renderbuffer_image EGLEW_GET_VAR(__EGLEW_KHR_gl_renderbuffer_image)
+#endif /* EGL_KHR_gl_renderbuffer_image */
+/* ---------------------- EGL_KHR_gl_texture_2D_image ---------------------- */
+#ifndef EGL_KHR_gl_texture_2D_image
+#define EGL_KHR_gl_texture_2D_image 1
+#define EGL_GL_TEXTURE_2D_KHR 0x30B1
+#define EGLEW_KHR_gl_texture_2D_image EGLEW_GET_VAR(__EGLEW_KHR_gl_texture_2D_image)
+#endif /* EGL_KHR_gl_texture_2D_image */
+/* ---------------------- EGL_KHR_gl_texture_3D_image ---------------------- */
+#ifndef EGL_KHR_gl_texture_3D_image
+#define EGL_KHR_gl_texture_3D_image 1
+#define EGL_GL_TEXTURE_3D_KHR 0x30B2
+#define EGLEW_KHR_gl_texture_3D_image EGLEW_GET_VAR(__EGLEW_KHR_gl_texture_3D_image)
+#endif /* EGL_KHR_gl_texture_3D_image */
+/* -------------------- EGL_KHR_gl_texture_cubemap_image ------------------- */
+#ifndef EGL_KHR_gl_texture_cubemap_image
+#define EGL_KHR_gl_texture_cubemap_image 1
+#define EGLEW_KHR_gl_texture_cubemap_image EGLEW_GET_VAR(__EGLEW_KHR_gl_texture_cubemap_image)
+#endif /* EGL_KHR_gl_texture_cubemap_image */
+/* ----------------------------- EGL_KHR_image ----------------------------- */
+#ifndef EGL_KHR_image
+#define EGL_KHR_image 1
+typedef EGLImageKHR ( * PFNEGLCREATEIMAGEKHRPROC) (EGLDisplay dpy, EGLContext ctx, EGLenum target, EGLClientBuffer buffer, const EGLint * attrib_list);
+typedef EGLBoolean ( * PFNEGLDESTROYIMAGEKHRPROC) (EGLDisplay dpy, EGLImageKHR image);
+#define eglCreateImageKHR EGLEW_GET_FUN(__eglewCreateImageKHR)
+#define eglDestroyImageKHR EGLEW_GET_FUN(__eglewDestroyImageKHR)
+#define EGLEW_KHR_image EGLEW_GET_VAR(__EGLEW_KHR_image)
+#endif /* EGL_KHR_image */
+/* --------------------------- EGL_KHR_image_base -------------------------- */
+#ifndef EGL_KHR_image_base
+#define EGL_KHR_image_base 1
+#define EGLEW_KHR_image_base EGLEW_GET_VAR(__EGLEW_KHR_image_base)
+#endif /* EGL_KHR_image_base */
+/* -------------------------- EGL_KHR_image_pixmap ------------------------- */
+#ifndef EGL_KHR_image_pixmap
+#define EGL_KHR_image_pixmap 1
+#define EGLEW_KHR_image_pixmap EGLEW_GET_VAR(__EGLEW_KHR_image_pixmap)
+#endif /* EGL_KHR_image_pixmap */
+/* -------------------------- EGL_KHR_lock_surface ------------------------- */
+#ifndef EGL_KHR_lock_surface
+#define EGL_KHR_lock_surface 1
+#define EGL_READ_SURFACE_BIT_KHR 0x0001
+#define EGL_LOCK_SURFACE_BIT_KHR 0x0080
+#define EGL_MATCH_FORMAT_KHR 0x3043
+#define EGL_FORMAT_RGB_565_EXACT_KHR 0x30C0
+#define EGL_FORMAT_RGB_565_KHR 0x30C1
+#define EGL_FORMAT_RGBA_8888_EXACT_KHR 0x30C2
+#define EGL_FORMAT_RGBA_8888_KHR 0x30C3
+#define EGL_BITMAP_PITCH_KHR 0x30C7
+#define EGL_LOWER_LEFT_KHR 0x30CE
+#define EGL_UPPER_LEFT_KHR 0x30CF
+typedef EGLBoolean ( * PFNEGLLOCKSURFACEKHRPROC) (EGLDisplay dpy, EGLSurface surface, const EGLint * attrib_list);
+typedef EGLBoolean ( * PFNEGLUNLOCKSURFACEKHRPROC) (EGLDisplay dpy, EGLSurface surface);
+#define eglLockSurfaceKHR EGLEW_GET_FUN(__eglewLockSurfaceKHR)
+#define eglUnlockSurfaceKHR EGLEW_GET_FUN(__eglewUnlockSurfaceKHR)
+#define EGLEW_KHR_lock_surface EGLEW_GET_VAR(__EGLEW_KHR_lock_surface)
+#endif /* EGL_KHR_lock_surface */
+/* ------------------------- EGL_KHR_lock_surface2 ------------------------- */
+#ifndef EGL_KHR_lock_surface2
+#define EGL_KHR_lock_surface2 1
+#define EGLEW_KHR_lock_surface2 EGLEW_GET_VAR(__EGLEW_KHR_lock_surface2)
+#endif /* EGL_KHR_lock_surface2 */
+/* ------------------------- EGL_KHR_lock_surface3 ------------------------- */
+#ifndef EGL_KHR_lock_surface3
+#define EGL_KHR_lock_surface3 1
+#define EGL_READ_SURFACE_BIT_KHR 0x0001
+#define EGL_LOCK_SURFACE_BIT_KHR 0x0080
+#define EGL_MATCH_FORMAT_KHR 0x3043
+#define EGL_FORMAT_RGB_565_EXACT_KHR 0x30C0
+#define EGL_FORMAT_RGB_565_KHR 0x30C1
+#define EGL_FORMAT_RGBA_8888_EXACT_KHR 0x30C2
+#define EGL_FORMAT_RGBA_8888_KHR 0x30C3
+#define EGL_BITMAP_PITCH_KHR 0x30C7
+#define EGL_LOWER_LEFT_KHR 0x30CE
+#define EGL_UPPER_LEFT_KHR 0x30CF
+typedef EGLBoolean ( * PFNEGLQUERYSURFACE64KHRPROC) (EGLDisplay dpy, EGLSurface surface, EGLint attribute, EGLAttribKHR * value);
+#define eglQuerySurface64KHR EGLEW_GET_FUN(__eglewQuerySurface64KHR)
+#define EGLEW_KHR_lock_surface3 EGLEW_GET_VAR(__EGLEW_KHR_lock_surface3)
+#endif /* EGL_KHR_lock_surface3 */
+/* --------------------- EGL_KHR_mutable_render_buffer --------------------- */
+#ifndef EGL_KHR_mutable_render_buffer
+#define EGL_KHR_mutable_render_buffer 1
+#define EGLEW_KHR_mutable_render_buffer EGLEW_GET_VAR(__EGLEW_KHR_mutable_render_buffer)
+#endif /* EGL_KHR_mutable_render_buffer */
+/* ----------------------- EGL_KHR_no_config_context ----------------------- */
+#ifndef EGL_KHR_no_config_context
+#define EGL_KHR_no_config_context 1
+#define EGLEW_KHR_no_config_context EGLEW_GET_VAR(__EGLEW_KHR_no_config_context)
+#endif /* EGL_KHR_no_config_context */
+/* ------------------------- EGL_KHR_partial_update ------------------------ */
+#ifndef EGL_KHR_partial_update
+#define EGL_KHR_partial_update 1
+#define EGL_BUFFER_AGE_KHR 0x313D
+typedef EGLBoolean ( * PFNEGLSETDAMAGEREGIONKHRPROC) (EGLDisplay dpy, EGLSurface surface, EGLint * rects, EGLint n_rects);
+#define eglSetDamageRegionKHR EGLEW_GET_FUN(__eglewSetDamageRegionKHR)
+#define EGLEW_KHR_partial_update EGLEW_GET_VAR(__EGLEW_KHR_partial_update)
+#endif /* EGL_KHR_partial_update */
+/* ------------------------ EGL_KHR_platform_android ----------------------- */
+#ifndef EGL_KHR_platform_android
+#define EGL_KHR_platform_android 1
+#define EGLEW_KHR_platform_android EGLEW_GET_VAR(__EGLEW_KHR_platform_android)
+#endif /* EGL_KHR_platform_android */
+/* -------------------------- EGL_KHR_platform_gbm ------------------------- */
+#ifndef EGL_KHR_platform_gbm
+#define EGL_KHR_platform_gbm 1
+#define EGL_PLATFORM_GBM_KHR 0x31D7
+#define EGLEW_KHR_platform_gbm EGLEW_GET_VAR(__EGLEW_KHR_platform_gbm)
+#endif /* EGL_KHR_platform_gbm */
+/* ------------------------ EGL_KHR_platform_wayland ----------------------- */
+#ifndef EGL_KHR_platform_wayland
+#define EGL_KHR_platform_wayland 1
+#define EGLEW_KHR_platform_wayland EGLEW_GET_VAR(__EGLEW_KHR_platform_wayland)
+#endif /* EGL_KHR_platform_wayland */
+/* -------------------------- EGL_KHR_platform_x11 ------------------------- */
+#ifndef EGL_KHR_platform_x11
+#define EGL_KHR_platform_x11 1
+#define EGL_PLATFORM_X11_KHR 0x31D5
+#define EGLEW_KHR_platform_x11 EGLEW_GET_VAR(__EGLEW_KHR_platform_x11)
+#endif /* EGL_KHR_platform_x11 */
+/* ------------------------- EGL_KHR_reusable_sync ------------------------- */
+#ifndef EGL_KHR_reusable_sync
+#define EGL_KHR_reusable_sync 1
+#define EGL_SYNC_STATUS_KHR 0x30F1
+#define EGL_SIGNALED_KHR 0x30F2
+#define EGL_UNSIGNALED_KHR 0x30F3
+#define EGL_SYNC_TYPE_KHR 0x30F7
+typedef EGLint ( * PFNEGLCLIENTWAITSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint flags, EGLTimeKHR timeout);
+typedef EGLSyncKHR ( * PFNEGLCREATESYNCKHRPROC) (EGLDisplay dpy, EGLenum type, const EGLint * attrib_list);
+typedef EGLBoolean ( * PFNEGLDESTROYSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync);
+typedef EGLBoolean ( * PFNEGLGETSYNCATTRIBKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint attribute, EGLint * value);
+typedef EGLBoolean ( * PFNEGLSIGNALSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLenum mode);
+#define eglClientWaitSyncKHR EGLEW_GET_FUN(__eglewClientWaitSyncKHR)
+#define eglCreateSyncKHR EGLEW_GET_FUN(__eglewCreateSyncKHR)
+#define eglDestroySyncKHR EGLEW_GET_FUN(__eglewDestroySyncKHR)
+#define eglGetSyncAttribKHR EGLEW_GET_FUN(__eglewGetSyncAttribKHR)
+#define eglSignalSyncKHR EGLEW_GET_FUN(__eglewSignalSyncKHR)
+#define EGLEW_KHR_reusable_sync EGLEW_GET_VAR(__EGLEW_KHR_reusable_sync)
+#endif /* EGL_KHR_reusable_sync */
+/* ----------------------------- EGL_KHR_stream ---------------------------- */
+#ifndef EGL_KHR_stream
+#define EGL_KHR_stream 1
+#define EGL_PRODUCER_FRAME_KHR 0x3212
+#define EGL_CONSUMER_FRAME_KHR 0x3213
+#define EGL_STREAM_STATE_KHR 0x3214
+#define EGL_BAD_STREAM_KHR 0x321B
+#define EGL_BAD_STATE_KHR 0x321C
+typedef EGLStreamKHR ( * PFNEGLCREATESTREAMKHRPROC) (EGLDisplay dpy, const EGLint * attrib_list);
+typedef EGLBoolean ( * PFNEGLDESTROYSTREAMKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream);
+typedef EGLBoolean ( * PFNEGLQUERYSTREAMKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLint * value);
+typedef EGLBoolean ( * PFNEGLQUERYSTREAMU64KHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLuint64KHR * value);
+typedef EGLBoolean ( * PFNEGLSTREAMATTRIBKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLint value);
+#define eglCreateStreamKHR EGLEW_GET_FUN(__eglewCreateStreamKHR)
+#define eglDestroyStreamKHR EGLEW_GET_FUN(__eglewDestroyStreamKHR)
+#define eglQueryStreamKHR EGLEW_GET_FUN(__eglewQueryStreamKHR)
+#define eglQueryStreamu64KHR EGLEW_GET_FUN(__eglewQueryStreamu64KHR)
+#define eglStreamAttribKHR EGLEW_GET_FUN(__eglewStreamAttribKHR)
+#define EGLEW_KHR_stream EGLEW_GET_VAR(__EGLEW_KHR_stream)
+#endif /* EGL_KHR_stream */
+/* ------------------------- EGL_KHR_stream_attrib ------------------------- */
+#ifndef EGL_KHR_stream_attrib
+#define EGL_KHR_stream_attrib 1
+#define EGL_STREAM_STATE_KHR 0x3214
+typedef EGLStreamKHR ( * PFNEGLCREATESTREAMATTRIBKHRPROC) (EGLDisplay dpy, const EGLAttrib * attrib_list);
+typedef EGLBoolean ( * PFNEGLQUERYSTREAMATTRIBKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLAttrib * value);
+typedef EGLBoolean ( * PFNEGLSETSTREAMATTRIBKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLAttrib value);
+typedef EGLBoolean ( * PFNEGLSTREAMCONSUMERACQUIREATTRIBKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, const EGLAttrib * attrib_list);
+typedef EGLBoolean ( * PFNEGLSTREAMCONSUMERRELEASEATTRIBKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, const EGLAttrib * attrib_list);
+#define eglCreateStreamAttribKHR EGLEW_GET_FUN(__eglewCreateStreamAttribKHR)
+#define eglQueryStreamAttribKHR EGLEW_GET_FUN(__eglewQueryStreamAttribKHR)
+#define eglSetStreamAttribKHR EGLEW_GET_FUN(__eglewSetStreamAttribKHR)
+#define eglStreamConsumerAcquireAttribKHR EGLEW_GET_FUN(__eglewStreamConsumerAcquireAttribKHR)
+#define eglStreamConsumerReleaseAttribKHR EGLEW_GET_FUN(__eglewStreamConsumerReleaseAttribKHR)
+#define EGLEW_KHR_stream_attrib EGLEW_GET_VAR(__EGLEW_KHR_stream_attrib)
+#endif /* EGL_KHR_stream_attrib */
+/* ------------------- EGL_KHR_stream_consumer_gltexture ------------------- */
+#ifndef EGL_KHR_stream_consumer_gltexture
+#define EGL_KHR_stream_consumer_gltexture 1
+typedef EGLBoolean ( * PFNEGLSTREAMCONSUMERACQUIREKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream);
+typedef EGLBoolean ( * PFNEGLSTREAMCONSUMERRELEASEKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream);
+#define eglStreamConsumerAcquireKHR EGLEW_GET_FUN(__eglewStreamConsumerAcquireKHR)
+#define eglStreamConsumerGLTextureExternalKHR EGLEW_GET_FUN(__eglewStreamConsumerGLTextureExternalKHR)
+#define eglStreamConsumerReleaseKHR EGLEW_GET_FUN(__eglewStreamConsumerReleaseKHR)
+#define EGLEW_KHR_stream_consumer_gltexture EGLEW_GET_VAR(__EGLEW_KHR_stream_consumer_gltexture)
+#endif /* EGL_KHR_stream_consumer_gltexture */
+/* -------------------- EGL_KHR_stream_cross_process_fd -------------------- */
+#ifndef EGL_KHR_stream_cross_process_fd
+#define EGL_KHR_stream_cross_process_fd 1
+typedef EGLStreamKHR ( * PFNEGLCREATESTREAMFROMFILEDESCRIPTORKHRPROC) (EGLDisplay dpy, EGLNativeFileDescriptorKHR file_descriptor);
+typedef EGLNativeFileDescriptorKHR ( * PFNEGLGETSTREAMFILEDESCRIPTORKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream);
+#define eglCreateStreamFromFileDescriptorKHR EGLEW_GET_FUN(__eglewCreateStreamFromFileDescriptorKHR)
+#define eglGetStreamFileDescriptorKHR EGLEW_GET_FUN(__eglewGetStreamFileDescriptorKHR)
+#define EGLEW_KHR_stream_cross_process_fd EGLEW_GET_VAR(__EGLEW_KHR_stream_cross_process_fd)
+#endif /* EGL_KHR_stream_cross_process_fd */
+/* -------------------------- EGL_KHR_stream_fifo -------------------------- */
+#ifndef EGL_KHR_stream_fifo
+#define EGL_KHR_stream_fifo 1
+typedef EGLBoolean ( * PFNEGLQUERYSTREAMTIMEKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLTimeKHR * value);
+#define eglQueryStreamTimeKHR EGLEW_GET_FUN(__eglewQueryStreamTimeKHR)
+#define EGLEW_KHR_stream_fifo EGLEW_GET_VAR(__EGLEW_KHR_stream_fifo)
+#endif /* EGL_KHR_stream_fifo */
+/* ----------------- EGL_KHR_stream_producer_aldatalocator ----------------- */
+#ifndef EGL_KHR_stream_producer_aldatalocator
+#define EGL_KHR_stream_producer_aldatalocator 1
+#define EGLEW_KHR_stream_producer_aldatalocator EGLEW_GET_VAR(__EGLEW_KHR_stream_producer_aldatalocator)
+#endif /* EGL_KHR_stream_producer_aldatalocator */
+/* ------------------- EGL_KHR_stream_producer_eglsurface ------------------ */
+#ifndef EGL_KHR_stream_producer_eglsurface
+#define EGL_KHR_stream_producer_eglsurface 1
+#define EGL_STREAM_BIT_KHR 0x0800
+typedef EGLSurface ( * PFNEGLCREATESTREAMPRODUCERSURFACEKHRPROC) (EGLDisplay dpy, EGLConfig config, EGLStreamKHR stream, const EGLint * attrib_list);
+#define eglCreateStreamProducerSurfaceKHR EGLEW_GET_FUN(__eglewCreateStreamProducerSurfaceKHR)
+#define EGLEW_KHR_stream_producer_eglsurface EGLEW_GET_VAR(__EGLEW_KHR_stream_producer_eglsurface)
+#endif /* EGL_KHR_stream_producer_eglsurface */
+/* ---------------------- EGL_KHR_surfaceless_context ---------------------- */
+#ifndef EGL_KHR_surfaceless_context
+#define EGL_KHR_surfaceless_context 1
+#define EGLEW_KHR_surfaceless_context EGLEW_GET_VAR(__EGLEW_KHR_surfaceless_context)
+#endif /* EGL_KHR_surfaceless_context */
+/* -------------------- EGL_KHR_swap_buffers_with_damage ------------------- */
+#ifndef EGL_KHR_swap_buffers_with_damage
+#define EGL_KHR_swap_buffers_with_damage 1
+typedef EGLBoolean ( * PFNEGLSWAPBUFFERSWITHDAMAGEKHRPROC) (EGLDisplay dpy, EGLSurface surface, EGLint * rects, EGLint n_rects);
+#define eglSwapBuffersWithDamageKHR EGLEW_GET_FUN(__eglewSwapBuffersWithDamageKHR)
+#define EGLEW_KHR_swap_buffers_with_damage EGLEW_GET_VAR(__EGLEW_KHR_swap_buffers_with_damage)
+#endif /* EGL_KHR_swap_buffers_with_damage */
+/* ------------------------ EGL_KHR_vg_parent_image ------------------------ */
+#ifndef EGL_KHR_vg_parent_image
+#define EGL_KHR_vg_parent_image 1
+#define EGLEW_KHR_vg_parent_image EGLEW_GET_VAR(__EGLEW_KHR_vg_parent_image)
+#endif /* EGL_KHR_vg_parent_image */
+/* --------------------------- EGL_KHR_wait_sync --------------------------- */
+#ifndef EGL_KHR_wait_sync
+#define EGL_KHR_wait_sync 1
+typedef EGLint ( * PFNEGLWAITSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint flags);
+#define eglWaitSyncKHR EGLEW_GET_FUN(__eglewWaitSyncKHR)
+#define EGLEW_KHR_wait_sync EGLEW_GET_VAR(__EGLEW_KHR_wait_sync)
+#endif /* EGL_KHR_wait_sync */
+/* --------------------------- EGL_MESA_drm_image -------------------------- */
+#ifndef EGL_MESA_drm_image
+#define EGL_MESA_drm_image 1
+#define EGL_DRM_BUFFER_USE_SHARE_MESA 0x00000002
+#define EGL_DRM_BUFFER_MESA 0x31D3
+typedef EGLImageKHR ( * PFNEGLCREATEDRMIMAGEMESAPROC) (EGLDisplay dpy, const EGLint * attrib_list);
+typedef EGLBoolean ( * PFNEGLEXPORTDRMIMAGEMESAPROC) (EGLDisplay dpy, EGLImageKHR image, EGLint * name, EGLint * handle, EGLint * stride);
+#define eglCreateDRMImageMESA EGLEW_GET_FUN(__eglewCreateDRMImageMESA)
+#define eglExportDRMImageMESA EGLEW_GET_FUN(__eglewExportDRMImageMESA)
+#define EGLEW_MESA_drm_image EGLEW_GET_VAR(__EGLEW_MESA_drm_image)
+#endif /* EGL_MESA_drm_image */
+/* --------------------- EGL_MESA_image_dma_buf_export --------------------- */
+#ifndef EGL_MESA_image_dma_buf_export
+#define EGL_MESA_image_dma_buf_export 1
+typedef EGLBoolean ( * PFNEGLEXPORTDMABUFIMAGEMESAPROC) (EGLDisplay dpy, EGLImageKHR image, int * fds, EGLint * strides, EGLint * offsets);
+typedef EGLBoolean ( * PFNEGLEXPORTDMABUFIMAGEQUERYMESAPROC) (EGLDisplay dpy, EGLImageKHR image, int * fourcc, int * num_planes, EGLuint64KHR * modifiers);
+#define eglExportDMABUFImageMESA EGLEW_GET_FUN(__eglewExportDMABUFImageMESA)
+#define eglExportDMABUFImageQueryMESA EGLEW_GET_FUN(__eglewExportDMABUFImageQueryMESA)
+#define EGLEW_MESA_image_dma_buf_export EGLEW_GET_VAR(__EGLEW_MESA_image_dma_buf_export)
+#endif /* EGL_MESA_image_dma_buf_export */
+/* ------------------------- EGL_MESA_platform_gbm ------------------------- */
+#ifndef EGL_MESA_platform_gbm
+#define EGL_MESA_platform_gbm 1
+#define EGLEW_MESA_platform_gbm EGLEW_GET_VAR(__EGLEW_MESA_platform_gbm)
+#endif /* EGL_MESA_platform_gbm */
+/* --------------------- EGL_MESA_platform_surfaceless --------------------- */
+#ifndef EGL_MESA_platform_surfaceless
+#define EGL_MESA_platform_surfaceless 1
+#define EGLEW_MESA_platform_surfaceless EGLEW_GET_VAR(__EGLEW_MESA_platform_surfaceless)
+#endif /* EGL_MESA_platform_surfaceless */
+/* -------------------------- EGL_NOK_swap_region -------------------------- */
+#ifndef EGL_NOK_swap_region
+#define EGL_NOK_swap_region 1
+typedef EGLBoolean ( * PFNEGLSWAPBUFFERSREGIONNOKPROC) (EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint * rects);
+#define eglSwapBuffersRegionNOK EGLEW_GET_FUN(__eglewSwapBuffersRegionNOK)
+#define EGLEW_NOK_swap_region EGLEW_GET_VAR(__EGLEW_NOK_swap_region)
+#endif /* EGL_NOK_swap_region */
+/* -------------------------- EGL_NOK_swap_region2 ------------------------- */
+#ifndef EGL_NOK_swap_region2
+#define EGL_NOK_swap_region2 1
+typedef EGLBoolean ( * PFNEGLSWAPBUFFERSREGION2NOKPROC) (EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint * rects);
+#define eglSwapBuffersRegion2NOK EGLEW_GET_FUN(__eglewSwapBuffersRegion2NOK)
+#define EGLEW_NOK_swap_region2 EGLEW_GET_VAR(__EGLEW_NOK_swap_region2)
+#endif /* EGL_NOK_swap_region2 */
+/* ---------------------- EGL_NOK_texture_from_pixmap ---------------------- */
+#ifndef EGL_NOK_texture_from_pixmap
+#define EGL_NOK_texture_from_pixmap 1
+#define EGL_Y_INVERTED_NOK 0x307F
+#define EGLEW_NOK_texture_from_pixmap EGLEW_GET_VAR(__EGLEW_NOK_texture_from_pixmap)
+#endif /* EGL_NOK_texture_from_pixmap */
+/* ------------------------ EGL_NV_3dvision_surface ------------------------ */
+#ifndef EGL_NV_3dvision_surface
+#define EGL_NV_3dvision_surface 1
+#define EGL_AUTO_STEREO_NV 0x3136
+#define EGLEW_NV_3dvision_surface EGLEW_GET_VAR(__EGLEW_NV_3dvision_surface)
+#endif /* EGL_NV_3dvision_surface */
+/* ------------------------- EGL_NV_coverage_sample ------------------------ */
+#ifndef EGL_NV_coverage_sample
+#define EGL_NV_coverage_sample 1
+#define EGLEW_NV_coverage_sample EGLEW_GET_VAR(__EGLEW_NV_coverage_sample)
+#endif /* EGL_NV_coverage_sample */
+/* --------------------- EGL_NV_coverage_sample_resolve -------------------- */
+#ifndef EGL_NV_coverage_sample_resolve
+#define EGL_NV_coverage_sample_resolve 1
+#define EGLEW_NV_coverage_sample_resolve EGLEW_GET_VAR(__EGLEW_NV_coverage_sample_resolve)
+#endif /* EGL_NV_coverage_sample_resolve */
+/* --------------------------- EGL_NV_cuda_event --------------------------- */
+#ifndef EGL_NV_cuda_event
+#define EGL_NV_cuda_event 1
+#define EGL_SYNC_CUDA_EVENT_NV 0x323C
+#define EGLEW_NV_cuda_event EGLEW_GET_VAR(__EGLEW_NV_cuda_event)
+#endif /* EGL_NV_cuda_event */
+/* ------------------------- EGL_NV_depth_nonlinear ------------------------ */
+#ifndef EGL_NV_depth_nonlinear
+#define EGL_NV_depth_nonlinear 1
+#define EGLEW_NV_depth_nonlinear EGLEW_GET_VAR(__EGLEW_NV_depth_nonlinear)
+#endif /* EGL_NV_depth_nonlinear */
+/* --------------------------- EGL_NV_device_cuda -------------------------- */
+#ifndef EGL_NV_device_cuda
+#define EGL_NV_device_cuda 1
+#define EGL_CUDA_DEVICE_NV 0x323A
+#define EGLEW_NV_device_cuda EGLEW_GET_VAR(__EGLEW_NV_device_cuda)
+#endif /* EGL_NV_device_cuda */
+/* -------------------------- EGL_NV_native_query -------------------------- */
+#ifndef EGL_NV_native_query
+#define EGL_NV_native_query 1
+typedef EGLBoolean ( * PFNEGLQUERYNATIVEDISPLAYNVPROC) (EGLDisplay dpy, EGLNativeDisplayType * display_id);
+typedef EGLBoolean ( * PFNEGLQUERYNATIVEPIXMAPNVPROC) (EGLDisplay dpy, EGLSurface surf, EGLNativePixmapType * pixmap);
+typedef EGLBoolean ( * PFNEGLQUERYNATIVEWINDOWNVPROC) (EGLDisplay dpy, EGLSurface surf, EGLNativeWindowType * window);
+#define eglQueryNativeDisplayNV EGLEW_GET_FUN(__eglewQueryNativeDisplayNV)
+#define eglQueryNativePixmapNV EGLEW_GET_FUN(__eglewQueryNativePixmapNV)
+#define eglQueryNativeWindowNV EGLEW_GET_FUN(__eglewQueryNativeWindowNV)
+#define EGLEW_NV_native_query EGLEW_GET_VAR(__EGLEW_NV_native_query)
+#endif /* EGL_NV_native_query */
+/* ---------------------- EGL_NV_post_convert_rounding --------------------- */
+#ifndef EGL_NV_post_convert_rounding
+#define EGL_NV_post_convert_rounding 1
+#define EGLEW_NV_post_convert_rounding EGLEW_GET_VAR(__EGLEW_NV_post_convert_rounding)
+#endif /* EGL_NV_post_convert_rounding */
+/* ------------------------- EGL_NV_post_sub_buffer ------------------------ */
+#ifndef EGL_NV_post_sub_buffer
+#define EGL_NV_post_sub_buffer 1
+typedef EGLBoolean ( * PFNEGLPOSTSUBBUFFERNVPROC) (EGLDisplay dpy, EGLSurface surface, EGLint x, EGLint y, EGLint width, EGLint height);
+#define eglPostSubBufferNV EGLEW_GET_FUN(__eglewPostSubBufferNV)
+#define EGLEW_NV_post_sub_buffer EGLEW_GET_VAR(__EGLEW_NV_post_sub_buffer)
+#endif /* EGL_NV_post_sub_buffer */
+/* ------------------ EGL_NV_robustness_video_memory_purge ----------------- */
+#ifndef EGL_NV_robustness_video_memory_purge
+#define EGL_NV_robustness_video_memory_purge 1
+#define EGLEW_NV_robustness_video_memory_purge EGLEW_GET_VAR(__EGLEW_NV_robustness_video_memory_purge)
+#endif /* EGL_NV_robustness_video_memory_purge */
+/* ------------------ EGL_NV_stream_consumer_gltexture_yuv ----------------- */
+#ifndef EGL_NV_stream_consumer_gltexture_yuv
+#define EGL_NV_stream_consumer_gltexture_yuv 1
+#define EGL_YUV_BUFFER_EXT 0x3300
+typedef EGLBoolean ( * PFNEGLSTREAMCONSUMERGLTEXTUREEXTERNALATTRIBSNVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLAttrib *attrib_list);
+#define eglStreamConsumerGLTextureExternalAttribsNV EGLEW_GET_FUN(__eglewStreamConsumerGLTextureExternalAttribsNV)
+#define EGLEW_NV_stream_consumer_gltexture_yuv EGLEW_GET_VAR(__EGLEW_NV_stream_consumer_gltexture_yuv)
+#endif /* EGL_NV_stream_consumer_gltexture_yuv */
+/* ---------------------- EGL_NV_stream_cross_display ---------------------- */
+#ifndef EGL_NV_stream_cross_display
+#define EGL_NV_stream_cross_display 1
+#define EGLEW_NV_stream_cross_display EGLEW_GET_VAR(__EGLEW_NV_stream_cross_display)
+#endif /* EGL_NV_stream_cross_display */
+/* ----------------------- EGL_NV_stream_cross_object ---------------------- */
+#ifndef EGL_NV_stream_cross_object
+#define EGL_NV_stream_cross_object 1
+#define EGLEW_NV_stream_cross_object EGLEW_GET_VAR(__EGLEW_NV_stream_cross_object)
+#endif /* EGL_NV_stream_cross_object */
+/* --------------------- EGL_NV_stream_cross_partition --------------------- */
+#ifndef EGL_NV_stream_cross_partition
+#define EGL_NV_stream_cross_partition 1
+#define EGLEW_NV_stream_cross_partition EGLEW_GET_VAR(__EGLEW_NV_stream_cross_partition)
+#endif /* EGL_NV_stream_cross_partition */
+/* ---------------------- EGL_NV_stream_cross_process ---------------------- */
+#ifndef EGL_NV_stream_cross_process
+#define EGL_NV_stream_cross_process 1
+#define EGLEW_NV_stream_cross_process EGLEW_GET_VAR(__EGLEW_NV_stream_cross_process)
+#endif /* EGL_NV_stream_cross_process */
+/* ----------------------- EGL_NV_stream_cross_system ---------------------- */
+#ifndef EGL_NV_stream_cross_system
+#define EGL_NV_stream_cross_system 1
+#define EGLEW_NV_stream_cross_system EGLEW_GET_VAR(__EGLEW_NV_stream_cross_system)
+#endif /* EGL_NV_stream_cross_system */
+/* ------------------------ EGL_NV_stream_fifo_next ------------------------ */
+#ifndef EGL_NV_stream_fifo_next
+#define EGL_NV_stream_fifo_next 1
+#define EGL_PENDING_FRAME_NV 0x3329
+#define EGLEW_NV_stream_fifo_next EGLEW_GET_VAR(__EGLEW_NV_stream_fifo_next)
+#endif /* EGL_NV_stream_fifo_next */
+/* --------------------- EGL_NV_stream_fifo_synchronous -------------------- */
+#ifndef EGL_NV_stream_fifo_synchronous
+#define EGL_NV_stream_fifo_synchronous 1
+#define EGLEW_NV_stream_fifo_synchronous EGLEW_GET_VAR(__EGLEW_NV_stream_fifo_synchronous)
+#endif /* EGL_NV_stream_fifo_synchronous */
+/* ----------------------- EGL_NV_stream_frame_limits ---------------------- */
+#ifndef EGL_NV_stream_frame_limits
+#define EGL_NV_stream_frame_limits 1
+#define EGLEW_NV_stream_frame_limits EGLEW_GET_VAR(__EGLEW_NV_stream_frame_limits)
+#endif /* EGL_NV_stream_frame_limits */
+/* ------------------------- EGL_NV_stream_metadata ------------------------ */
+#ifndef EGL_NV_stream_metadata
+#define EGL_NV_stream_metadata 1
+#define EGL_METADATA0_SIZE_NV 0x3255
+#define EGL_METADATA1_SIZE_NV 0x3256
+#define EGL_METADATA2_SIZE_NV 0x3257
+#define EGL_METADATA3_SIZE_NV 0x3258
+#define EGL_METADATA0_TYPE_NV 0x3259
+#define EGL_METADATA1_TYPE_NV 0x325A
+#define EGL_METADATA2_TYPE_NV 0x325B
+#define EGL_METADATA3_TYPE_NV 0x325C
+typedef EGLBoolean ( * PFNEGLQUERYDISPLAYATTRIBNVPROC) (EGLDisplay dpy, EGLint attribute, EGLAttrib * value);
+typedef EGLBoolean ( * PFNEGLQUERYSTREAMMETADATANVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum name, EGLint n, EGLint offset, EGLint size, void * data);
+typedef EGLBoolean ( * PFNEGLSETSTREAMMETADATANVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLint n, EGLint offset, EGLint size, const void * data);
+#define eglQueryDisplayAttribNV EGLEW_GET_FUN(__eglewQueryDisplayAttribNV)
+#define eglQueryStreamMetadataNV EGLEW_GET_FUN(__eglewQueryStreamMetadataNV)
+#define eglSetStreamMetadataNV EGLEW_GET_FUN(__eglewSetStreamMetadataNV)
+#define EGLEW_NV_stream_metadata EGLEW_GET_VAR(__EGLEW_NV_stream_metadata)
+#endif /* EGL_NV_stream_metadata */
+/* -------------------------- EGL_NV_stream_remote ------------------------- */
+#ifndef EGL_NV_stream_remote
+#define EGL_NV_stream_remote 1
+#define EGL_STREAM_TYPE_NV 0x3241
+#define EGL_STREAM_PROTOCOL_NV 0x3242
+#define EGL_STREAM_ENDPOINT_NV 0x3243
+#define EGL_STREAM_LOCAL_NV 0x3244
+#define EGL_STREAM_PRODUCER_NV 0x3247
+#define EGL_STREAM_CONSUMER_NV 0x3248
+#define EGLEW_NV_stream_remote EGLEW_GET_VAR(__EGLEW_NV_stream_remote)
+#endif /* EGL_NV_stream_remote */
+/* -------------------------- EGL_NV_stream_reset -------------------------- */
+#ifndef EGL_NV_stream_reset
+#define EGL_NV_stream_reset 1
+#define EGL_SUPPORT_RESET_NV 0x3334
+#define EGL_SUPPORT_REUSE_NV 0x3335
+typedef EGLBoolean ( * PFNEGLRESETSTREAMNVPROC) (EGLDisplay dpy, EGLStreamKHR stream);
+#define eglResetStreamNV EGLEW_GET_FUN(__eglewResetStreamNV)
+#define EGLEW_NV_stream_reset EGLEW_GET_VAR(__EGLEW_NV_stream_reset)
+#endif /* EGL_NV_stream_reset */
+/* -------------------------- EGL_NV_stream_socket ------------------------- */
+#ifndef EGL_NV_stream_socket
+#define EGL_NV_stream_socket 1
+#define EGL_SOCKET_HANDLE_NV 0x324C
+#define EGL_SOCKET_TYPE_NV 0x324D
+#define EGLEW_NV_stream_socket EGLEW_GET_VAR(__EGLEW_NV_stream_socket)
+#endif /* EGL_NV_stream_socket */
+/* ----------------------- EGL_NV_stream_socket_inet ----------------------- */
+#ifndef EGL_NV_stream_socket_inet
+#define EGL_NV_stream_socket_inet 1
+#define EGLEW_NV_stream_socket_inet EGLEW_GET_VAR(__EGLEW_NV_stream_socket_inet)
+#endif /* EGL_NV_stream_socket_inet */
+/* ----------------------- EGL_NV_stream_socket_unix ----------------------- */
+#ifndef EGL_NV_stream_socket_unix
+#define EGL_NV_stream_socket_unix 1
+#define EGLEW_NV_stream_socket_unix EGLEW_GET_VAR(__EGLEW_NV_stream_socket_unix)
+#endif /* EGL_NV_stream_socket_unix */
+/* --------------------------- EGL_NV_stream_sync -------------------------- */
+#ifndef EGL_NV_stream_sync
+#define EGL_NV_stream_sync 1
+#define EGL_SYNC_TYPE_KHR 0x30F7
+#define EGL_SYNC_NEW_FRAME_NV 0x321F
+typedef EGLSyncKHR ( * PFNEGLCREATESTREAMSYNCNVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum type, const EGLint * attrib_list);
+#define eglCreateStreamSyncNV EGLEW_GET_FUN(__eglewCreateStreamSyncNV)
+#define EGLEW_NV_stream_sync EGLEW_GET_VAR(__EGLEW_NV_stream_sync)
+#endif /* EGL_NV_stream_sync */
+/* ------------------------------ EGL_NV_sync ------------------------------ */
+#ifndef EGL_NV_sync
+#define EGL_NV_sync 1
+#define EGL_SYNC_STATUS_NV 0x30E7
+#define EGL_SIGNALED_NV 0x30E8
+#define EGL_UNSIGNALED_NV 0x30E9
+#define EGL_SYNC_TYPE_NV 0x30ED
+#define EGL_SYNC_FENCE_NV 0x30EF
+typedef EGLint ( * PFNEGLCLIENTWAITSYNCNVPROC) (EGLSyncNV sync, EGLint flags, EGLTimeNV timeout);
+typedef EGLSyncNV ( * PFNEGLCREATEFENCESYNCNVPROC) (EGLDisplay dpy, EGLenum condition, const EGLint * attrib_list);
+typedef EGLBoolean ( * PFNEGLDESTROYSYNCNVPROC) (EGLSyncNV sync);
+typedef EGLBoolean ( * PFNEGLFENCENVPROC) (EGLSyncNV sync);
+typedef EGLBoolean ( * PFNEGLGETSYNCATTRIBNVPROC) (EGLSyncNV sync, EGLint attribute, EGLint * value);
+typedef EGLBoolean ( * PFNEGLSIGNALSYNCNVPROC) (EGLSyncNV sync, EGLenum mode);
+#define eglClientWaitSyncNV EGLEW_GET_FUN(__eglewClientWaitSyncNV)
+#define eglCreateFenceSyncNV EGLEW_GET_FUN(__eglewCreateFenceSyncNV)
+#define eglDestroySyncNV EGLEW_GET_FUN(__eglewDestroySyncNV)
+#define eglFenceNV EGLEW_GET_FUN(__eglewFenceNV)
+#define eglGetSyncAttribNV EGLEW_GET_FUN(__eglewGetSyncAttribNV)
+#define eglSignalSyncNV EGLEW_GET_FUN(__eglewSignalSyncNV)
+#define EGLEW_NV_sync EGLEW_GET_VAR(__EGLEW_NV_sync)
+#endif /* EGL_NV_sync */
+/* --------------------------- EGL_NV_system_time -------------------------- */
+#ifndef EGL_NV_system_time
+#define EGL_NV_system_time 1
+typedef EGLuint64NV ( * PFNEGLGETSYSTEMTIMENVPROC) ( void );
+#define eglGetSystemTimeFrequencyNV EGLEW_GET_FUN(__eglewGetSystemTimeFrequencyNV)
+#define eglGetSystemTimeNV EGLEW_GET_FUN(__eglewGetSystemTimeNV)
+#define EGLEW_NV_system_time EGLEW_GET_VAR(__EGLEW_NV_system_time)
+#endif /* EGL_NV_system_time */
+/* --------------------- EGL_TIZEN_image_native_buffer --------------------- */
+#ifndef EGL_TIZEN_image_native_buffer
+#define EGL_TIZEN_image_native_buffer 1
+#define EGLEW_TIZEN_image_native_buffer EGLEW_GET_VAR(__EGLEW_TIZEN_image_native_buffer)
+#endif /* EGL_TIZEN_image_native_buffer */
+/* --------------------- EGL_TIZEN_image_native_surface -------------------- */
+#ifndef EGL_TIZEN_image_native_surface
+#define EGL_TIZEN_image_native_surface 1
+#define EGLEW_TIZEN_image_native_surface EGLEW_GET_VAR(__EGLEW_TIZEN_image_native_surface)
+#endif /* EGL_TIZEN_image_native_surface */
+/* ------------------------------------------------------------------------- */
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_create_native_client_buffer;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_framebuffer_target;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_front_buffer_auto_refresh;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_image_native_buffer;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_native_fence_sync;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_presentation_time;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANGLE_d3d_share_handle_client_buffer;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANGLE_device_d3d;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANGLE_query_surface_pointer;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANGLE_surface_d3d_texture_2d_share_handle;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ANGLE_window_fixed_size;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ARM_implicit_external_sync;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_ARM_pixmap_multisample_discard;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_buffer_age;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_client_extensions;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_create_context_robustness;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_device_base;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_device_drm;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_device_enumeration;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_device_openwf;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_device_query;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_gl_colorspace_bt2020_linear;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_gl_colorspace_bt2020_pq;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_gl_colorspace_scrgb_linear;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_image_dma_buf_import;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_image_dma_buf_import_modifiers;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_multiview_window;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_output_base;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_output_drm;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_output_openwf;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_pixel_format_float;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_platform_base;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_platform_device;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_platform_wayland;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_platform_x11;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_protected_content;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_protected_surface;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_stream_consumer_egloutput;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_surface_SMPTE2086_metadata;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_swap_buffers_with_damage;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_yuv_surface;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_HI_clientpixmap;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_HI_colorformats;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_IMG_context_priority;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_IMG_image_plane_attribs;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_cl_event;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_cl_event2;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_client_get_all_proc_addresses;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_config_attribs;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_context_flush_control;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_create_context;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_create_context_no_error;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_fence_sync;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_get_all_proc_addresses;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_gl_colorspace;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_gl_renderbuffer_image;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_gl_texture_2D_image;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_gl_texture_3D_image;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_gl_texture_cubemap_image;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_image_base;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_image_pixmap;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_lock_surface;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_lock_surface2;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_lock_surface3;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_mutable_render_buffer;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_no_config_context;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_partial_update;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_platform_android;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_platform_gbm;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_platform_wayland;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_platform_x11;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_reusable_sync;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_attrib;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_consumer_gltexture;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_cross_process_fd;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_fifo;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_producer_aldatalocator;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_producer_eglsurface;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_surfaceless_context;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_swap_buffers_with_damage;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_vg_parent_image;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_wait_sync;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_MESA_drm_image;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_MESA_image_dma_buf_export;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_MESA_platform_gbm;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_MESA_platform_surfaceless;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NOK_swap_region;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NOK_swap_region2;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NOK_texture_from_pixmap;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_3dvision_surface;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_coverage_sample;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_coverage_sample_resolve;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_cuda_event;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_depth_nonlinear;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_device_cuda;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_native_query;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_post_convert_rounding;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_post_sub_buffer;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_robustness_video_memory_purge;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_consumer_gltexture_yuv;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_cross_display;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_cross_object;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_cross_partition;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_cross_process;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_cross_system;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_fifo_next;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_fifo_synchronous;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_frame_limits;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_metadata;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_remote;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_reset;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_socket;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_socket_inet;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_socket_unix;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_sync;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_system_time;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_TIZEN_image_native_buffer;
+EGLEW_VAR_EXPORT GLboolean __EGLEW_TIZEN_image_native_surface;
+/* ------------------------------------------------------------------------ */
+GLEWAPI GLenum GLEWAPIENTRY eglewInit (EGLDisplay display);
+GLEWAPI GLboolean GLEWAPIENTRY eglewIsSupported (const char *name);
+#define EGLEW_GET_VAR(x) (*(const GLboolean*)&x)
+#define EGLEW_GET_FUN(x) x
+GLEWAPI GLboolean GLEWAPIENTRY eglewGetExtension (const char *name);
+#ifdef __cplusplus
+#endif /* __eglew_h__ */
diff --git a/glew-2.1.0/GL/glew.h b/glew-2.1.0/GL/glew.h
new file mode 100644
index 0000000..b5b6987
--- /dev/null
+++ b/glew-2.1.0/GL/glew.h
@@ -0,0 +1,23686 @@
+** The OpenGL Extension Wrangler Library
+** Copyright (C) 2008-2017, Nigel Stewart <nigels[]users sourceforge net>
+** Copyright (C) 2002-2008, Milan Ikits <milan ikits[]ieee org>
+** Copyright (C) 2002-2008, Marcelo E. Magallon <mmagallo[]debian org>
+** Copyright (C) 2002, Lev Povalahev
+** All rights reserved.
+** Redistribution and use in source and binary forms, with or without
+** modification, are permitted provided that the following conditions are met:
+** * Redistributions of source code must retain the above copyright notice,
+** this list of conditions and the following disclaimer.
+** * Redistributions in binary form must reproduce the above copyright notice,
+** this list of conditions and the following disclaimer in the documentation
+** and/or other materials provided with the distribution.
+** * The name of the author may be used to endorse or promote products
+** derived from this software without specific prior written permission.
+ * Mesa 3-D graphics library
+ * Version: 7.0
+ *
+ * Copyright (C) 1999-2007 Brian Paul All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the "Software"),
+ * to deal in the Software without restriction, including without limitation
+ * the rights to use, copy, modify, merge, publish, distribute, sublicense,
+ * and/or sell copies of the Software, and to permit persons to whom the
+ * Software is furnished to do so, subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included
+ * in all copies or substantial portions of the Software.
+ *
+ */
+** Copyright (c) 2007 The Khronos Group Inc.
+** Permission is hereby granted, free of charge, to any person obtaining a
+** copy of this software and/or associated documentation files (the
+** "Materials"), to deal in the Materials without restriction, including
+** without limitation the rights to use, copy, modify, merge, publish,
+** distribute, sublicense, and/or sell copies of the Materials, and to
+** permit persons to whom the Materials are furnished to do so, subject to
+** the following conditions:
+** The above copyright notice and this permission notice shall be included
+** in all copies or substantial portions of the Materials.
+#ifndef __glew_h__
+#define __glew_h__
+#define __GLEW_H__
+#if defined(__gl_h_) || defined(__GL_H__) || defined(_GL_H) || defined(__X_GL_H)
+#error gl.h included before glew.h
+#if defined(__gl2_h_)
+#error gl2.h included before glew.h
+#if defined(__gltypes_h_)
+#error gltypes.h included before glew.h
+#if defined(__REGAL_H__)
+#error Regal.h included before glew.h
+#if defined(__glext_h_) || defined(__GLEXT_H_)
+#error glext.h included before glew.h
+#if defined(__gl_ATI_h_)
+#error glATI.h included before glew.h
+#define __gl_h_
+#define __gl2_h_
+#define __GL_H__
+#define _GL_H
+#define __gltypes_h_
+#define __REGAL_H__
+#define __X_GL_H
+#define __glext_h_
+#define __GLEXT_H_
+#define __gl_ATI_h_
+#if defined(_WIN32)
+ * GLEW does not include <windows.h> to avoid name space pollution.
+ * GL needs GLAPI and GLAPIENTRY, GLU needs APIENTRY, CALLBACK, and wchar_t
+ * defined properly.
+ */
+/* <windef.h> and <gl.h>*/
+#ifdef APIENTRY
+# ifndef GLAPIENTRY
+# endif
+# endif
+# if defined(__MINGW32__) || defined(__CYGWIN__) || (_MSC_VER >= 800) || defined(_STDCALL_SUPPORTED) || defined(__BORLANDC__)
+# define APIENTRY __stdcall
+# ifndef GLAPIENTRY
+# define GLAPIENTRY __stdcall
+# endif
+# define GLEWAPIENTRY __stdcall
+# endif
+# else
+# define APIENTRY
+# endif
+#ifndef GLAPI
+# if defined(__MINGW32__) || defined(__CYGWIN__)
+# define GLAPI extern
+# endif
+/* <winnt.h> */
+#ifndef CALLBACK
+# if defined(__MINGW32__) || defined(__CYGWIN__)
+# define CALLBACK __attribute__ ((__stdcall__))
+# elif (defined(_M_MRX000) || defined(_M_IX86) || defined(_M_ALPHA) || defined(_M_PPC)) && !defined(MIDL_PASS)
+# define CALLBACK __stdcall
+# else
+# define CALLBACK
+# endif
+/* <wingdi.h> and <winnt.h> */
+#ifndef WINGDIAPI
+#define WINGDIAPI __declspec(dllimport)
+/* <ctype.h> */
+#if (defined(_MSC_VER) || defined(__BORLANDC__)) && !defined(_WCHAR_T_DEFINED)
+typedef unsigned short wchar_t;
+# define _WCHAR_T_DEFINED
+/* <stddef.h> */
+#if !defined(_W64)
+# if !defined(__midl) && (defined(_X86_) || defined(_M_IX86)) && defined(_MSC_VER) && _MSC_VER >= 1300
+# define _W64 __w64
+# else
+# define _W64
+# endif
+#if !defined(_PTRDIFF_T_DEFINED) && !defined(_PTRDIFF_T_) && !defined(__MINGW64__)
+# ifdef _WIN64
+typedef __int64 ptrdiff_t;
+# else
+typedef _W64 int ptrdiff_t;
+# endif
+# define _PTRDIFF_T_
+#ifndef GLAPI
+# if defined(__MINGW32__) || defined(__CYGWIN__)
+# define GLAPI extern
+# else
+# endif
+ * GLEW_STATIC is defined for static library.
+ * GLEW_BUILD is defined for building the DLL library.
+ */
+# define GLEWAPI extern
+# ifdef GLEW_BUILD
+# define GLEWAPI extern __declspec(dllexport)
+# else
+# define GLEWAPI extern __declspec(dllimport)
+# endif
+#else /* _UNIX */
+ * Needed for ptrdiff_t in turn needed by VBO. This is defined by ISO
+ * C. On my system, this amounts to _3 lines_ of included code, all of
+ * them pretty much harmless. If you know of a way of detecting 32 vs
+ * 64 _targets_ at compile time you are free to replace this with
+ * something that's portable. For now, _this_ is the portable solution.
+ * (mem, 2004-01-04)
+ */
+#include <stddef.h>
+/* SGI MIPSPro doesn't like stdint.h in C++ mode */
+/* ID: 3376260 Solaris 9 has inttypes.h, but not stdint.h */
+#if (defined(__sgi) || defined(__sun)) && !defined(__GNUC__)
+#include <inttypes.h>
+#include <stdint.h>
+#define APIENTRY
+ * GLEW_STATIC is defined for static library.
+ */
+# define GLEWAPI extern
+# if defined(__GNUC__) && __GNUC__>=4
+# define GLEWAPI extern __attribute__ ((visibility("default")))
+# elif defined(__SUNPRO_C) || defined(__SUNPRO_CC)
+# define GLEWAPI extern __global
+# else
+# define GLEWAPI extern
+# endif
+/* <glu.h> */
+#ifndef GLAPI
+#define GLAPI extern
+#endif /* _WIN32 */
+#ifdef __cplusplus
+extern "C" {
+/* ----------------------------- GL_VERSION_1_1 ---------------------------- */
+#ifndef GL_VERSION_1_1
+#define GL_VERSION_1_1 1
+typedef unsigned int GLenum;
+typedef unsigned int GLbitfield;
+typedef unsigned int GLuint;
+typedef int GLint;
+typedef int GLsizei;
+typedef unsigned char GLboolean;
+typedef signed char GLbyte;
+typedef short GLshort;
+typedef unsigned char GLubyte;
+typedef unsigned short GLushort;
+typedef unsigned long GLulong;
+typedef float GLfloat;
+typedef float GLclampf;
+typedef double GLdouble;
+typedef double GLclampd;
+typedef void GLvoid;
+#if defined(_MSC_VER) && _MSC_VER < 1400
+typedef __int64 GLint64EXT;
+typedef unsigned __int64 GLuint64EXT;
+#elif defined(_MSC_VER) || defined(__BORLANDC__)
+typedef signed long long GLint64EXT;
+typedef unsigned long long GLuint64EXT;
+# if defined(__MINGW32__) || defined(__CYGWIN__)
+#include <inttypes.h>
+# endif
+typedef int64_t GLint64EXT;
+typedef uint64_t GLuint64EXT;
+typedef GLint64EXT GLint64;
+typedef GLuint64EXT GLuint64;
+typedef struct __GLsync *GLsync;
+typedef char GLchar;
+#define GL_ZERO 0
+#define GL_FALSE 0
+#define GL_LOGIC_OP 0x0BF1
+#define GL_NONE 0
+#define GL_NO_ERROR 0
+#define GL_POINTS 0x0000
+#define GL_CURRENT_BIT 0x00000001
+#define GL_TRUE 1
+#define GL_ONE 1
+#define GL_CLIENT_PIXEL_STORE_BIT 0x00000001
+#define GL_LINES 0x0001
+#define GL_LINE_LOOP 0x0002
+#define GL_POINT_BIT 0x00000002
+#define GL_CLIENT_VERTEX_ARRAY_BIT 0x00000002
+#define GL_LINE_STRIP 0x0003
+#define GL_LINE_BIT 0x00000004
+#define GL_TRIANGLES 0x0004
+#define GL_TRIANGLE_STRIP 0x0005
+#define GL_TRIANGLE_FAN 0x0006
+#define GL_QUADS 0x0007
+#define GL_QUAD_STRIP 0x0008
+#define GL_POLYGON_BIT 0x00000008
+#define GL_POLYGON 0x0009
+#define GL_POLYGON_STIPPLE_BIT 0x00000010
+#define GL_PIXEL_MODE_BIT 0x00000020
+#define GL_LIGHTING_BIT 0x00000040
+#define GL_FOG_BIT 0x00000080
+#define GL_DEPTH_BUFFER_BIT 0x00000100
+#define GL_ACCUM 0x0100
+#define GL_LOAD 0x0101
+#define GL_RETURN 0x0102
+#define GL_MULT 0x0103
+#define GL_ADD 0x0104
+#define GL_NEVER 0x0200
+#define GL_ACCUM_BUFFER_BIT 0x00000200
+#define GL_LESS 0x0201
+#define GL_EQUAL 0x0202
+#define GL_LEQUAL 0x0203
+#define GL_GREATER 0x0204
+#define GL_NOTEQUAL 0x0205
+#define GL_GEQUAL 0x0206
+#define GL_ALWAYS 0x0207
+#define GL_SRC_COLOR 0x0300
+#define GL_ONE_MINUS_SRC_COLOR 0x0301
+#define GL_SRC_ALPHA 0x0302
+#define GL_ONE_MINUS_SRC_ALPHA 0x0303
+#define GL_DST_ALPHA 0x0304
+#define GL_ONE_MINUS_DST_ALPHA 0x0305
+#define GL_DST_COLOR 0x0306
+#define GL_ONE_MINUS_DST_COLOR 0x0307
+#define GL_SRC_ALPHA_SATURATE 0x0308
+#define GL_STENCIL_BUFFER_BIT 0x00000400
+#define GL_FRONT_LEFT 0x0400
+#define GL_FRONT_RIGHT 0x0401
+#define GL_BACK_LEFT 0x0402
+#define GL_BACK_RIGHT 0x0403
+#define GL_FRONT 0x0404
+#define GL_BACK 0x0405
+#define GL_LEFT 0x0406
+#define GL_RIGHT 0x0407
+#define GL_FRONT_AND_BACK 0x0408
+#define GL_AUX0 0x0409
+#define GL_AUX1 0x040A
+#define GL_AUX2 0x040B
+#define GL_AUX3 0x040C
+#define GL_INVALID_ENUM 0x0500
+#define GL_INVALID_VALUE 0x0501
+#define GL_INVALID_OPERATION 0x0502
+#define GL_STACK_OVERFLOW 0x0503
+#define GL_STACK_UNDERFLOW 0x0504
+#define GL_OUT_OF_MEMORY 0x0505
+#define GL_2D 0x0600
+#define GL_3D 0x0601
+#define GL_3D_COLOR 0x0602
+#define GL_3D_COLOR_TEXTURE 0x0603
+#define GL_4D_COLOR_TEXTURE 0x0604
+#define GL_PASS_THROUGH_TOKEN 0x0700
+#define GL_POINT_TOKEN 0x0701
+#define GL_LINE_TOKEN 0x0702
+#define GL_POLYGON_TOKEN 0x0703
+#define GL_BITMAP_TOKEN 0x0704
+#define GL_DRAW_PIXEL_TOKEN 0x0705
+#define GL_COPY_PIXEL_TOKEN 0x0706
+#define GL_LINE_RESET_TOKEN 0x0707
+#define GL_EXP 0x0800
+#define GL_VIEWPORT_BIT 0x00000800
+#define GL_EXP2 0x0801
+#define GL_CW 0x0900
+#define GL_CCW 0x0901
+#define GL_COEFF 0x0A00
+#define GL_ORDER 0x0A01
+#define GL_DOMAIN 0x0A02
+#define GL_CURRENT_COLOR 0x0B00
+#define GL_CURRENT_INDEX 0x0B01
+#define GL_CURRENT_NORMAL 0x0B02
+#define GL_POINT_SMOOTH 0x0B10
+#define GL_POINT_SIZE 0x0B11
+#define GL_POINT_SIZE_RANGE 0x0B12
+#define GL_LINE_SMOOTH 0x0B20
+#define GL_LINE_WIDTH 0x0B21
+#define GL_LINE_WIDTH_RANGE 0x0B22
+#define GL_LINE_STIPPLE 0x0B24
+#define GL_LIST_MODE 0x0B30
+#define GL_MAX_LIST_NESTING 0x0B31
+#define GL_LIST_BASE 0x0B32
+#define GL_LIST_INDEX 0x0B33
+#define GL_POLYGON_MODE 0x0B40
+#define GL_POLYGON_SMOOTH 0x0B41
+#define GL_POLYGON_STIPPLE 0x0B42
+#define GL_EDGE_FLAG 0x0B43
+#define GL_CULL_FACE 0x0B44
+#define GL_CULL_FACE_MODE 0x0B45
+#define GL_FRONT_FACE 0x0B46
+#define GL_LIGHTING 0x0B50
+#define GL_SHADE_MODEL 0x0B54
+#define GL_COLOR_MATERIAL 0x0B57
+#define GL_FOG 0x0B60
+#define GL_FOG_INDEX 0x0B61
+#define GL_FOG_DENSITY 0x0B62
+#define GL_FOG_START 0x0B63
+#define GL_FOG_END 0x0B64
+#define GL_FOG_MODE 0x0B65
+#define GL_FOG_COLOR 0x0B66
+#define GL_DEPTH_RANGE 0x0B70
+#define GL_DEPTH_TEST 0x0B71
+#define GL_DEPTH_WRITEMASK 0x0B72
+#define GL_DEPTH_CLEAR_VALUE 0x0B73
+#define GL_DEPTH_FUNC 0x0B74
+#define GL_ACCUM_CLEAR_VALUE 0x0B80
+#define GL_STENCIL_TEST 0x0B90
+#define GL_STENCIL_FUNC 0x0B92
+#define GL_STENCIL_FAIL 0x0B94
+#define GL_STENCIL_REF 0x0B97
+#define GL_MATRIX_MODE 0x0BA0
+#define GL_NORMALIZE 0x0BA1
+#define GL_VIEWPORT 0x0BA2
+#define GL_ALPHA_TEST 0x0BC0
+#define GL_ALPHA_TEST_FUNC 0x0BC1
+#define GL_ALPHA_TEST_REF 0x0BC2
+#define GL_DITHER 0x0BD0
+#define GL_BLEND_DST 0x0BE0
+#define GL_BLEND_SRC 0x0BE1
+#define GL_BLEND 0x0BE2
+#define GL_LOGIC_OP_MODE 0x0BF0
+#define GL_INDEX_LOGIC_OP 0x0BF1
+#define GL_COLOR_LOGIC_OP 0x0BF2
+#define GL_AUX_BUFFERS 0x0C00
+#define GL_DRAW_BUFFER 0x0C01
+#define GL_READ_BUFFER 0x0C02
+#define GL_SCISSOR_BOX 0x0C10
+#define GL_SCISSOR_TEST 0x0C11
+#define GL_INDEX_CLEAR_VALUE 0x0C20
+#define GL_INDEX_WRITEMASK 0x0C21
+#define GL_COLOR_CLEAR_VALUE 0x0C22
+#define GL_COLOR_WRITEMASK 0x0C23
+#define GL_INDEX_MODE 0x0C30
+#define GL_RGBA_MODE 0x0C31
+#define GL_DOUBLEBUFFER 0x0C32
+#define GL_STEREO 0x0C33
+#define GL_RENDER_MODE 0x0C40
+#define GL_POINT_SMOOTH_HINT 0x0C51
+#define GL_LINE_SMOOTH_HINT 0x0C52
+#define GL_FOG_HINT 0x0C54
+#define GL_TEXTURE_GEN_S 0x0C60
+#define GL_TEXTURE_GEN_T 0x0C61
+#define GL_TEXTURE_GEN_R 0x0C62
+#define GL_TEXTURE_GEN_Q 0x0C63
+#define GL_PIXEL_MAP_I_TO_I 0x0C70
+#define GL_PIXEL_MAP_S_TO_S 0x0C71
+#define GL_PIXEL_MAP_I_TO_R 0x0C72
+#define GL_PIXEL_MAP_I_TO_G 0x0C73
+#define GL_PIXEL_MAP_I_TO_B 0x0C74
+#define GL_PIXEL_MAP_I_TO_A 0x0C75
+#define GL_PIXEL_MAP_R_TO_R 0x0C76
+#define GL_PIXEL_MAP_G_TO_G 0x0C77
+#define GL_PIXEL_MAP_B_TO_B 0x0C78
+#define GL_PIXEL_MAP_A_TO_A 0x0C79
+#define GL_PIXEL_MAP_I_TO_I_SIZE 0x0CB0
+#define GL_PIXEL_MAP_S_TO_S_SIZE 0x0CB1
+#define GL_PIXEL_MAP_I_TO_R_SIZE 0x0CB2
+#define GL_PIXEL_MAP_I_TO_G_SIZE 0x0CB3
+#define GL_PIXEL_MAP_I_TO_B_SIZE 0x0CB4
+#define GL_PIXEL_MAP_I_TO_A_SIZE 0x0CB5
+#define GL_PIXEL_MAP_R_TO_R_SIZE 0x0CB6
+#define GL_PIXEL_MAP_G_TO_G_SIZE 0x0CB7
+#define GL_PIXEL_MAP_B_TO_B_SIZE 0x0CB8
+#define GL_PIXEL_MAP_A_TO_A_SIZE 0x0CB9
+#define GL_PACK_SWAP_BYTES 0x0D00
+#define GL_PACK_LSB_FIRST 0x0D01
+#define GL_PACK_ROW_LENGTH 0x0D02
+#define GL_PACK_SKIP_ROWS 0x0D03
+#define GL_PACK_SKIP_PIXELS 0x0D04
+#define GL_PACK_ALIGNMENT 0x0D05
+#define GL_MAP_COLOR 0x0D10
+#define GL_MAP_STENCIL 0x0D11
+#define GL_INDEX_SHIFT 0x0D12
+#define GL_INDEX_OFFSET 0x0D13
+#define GL_RED_SCALE 0x0D14
+#define GL_RED_BIAS 0x0D15
+#define GL_ZOOM_X 0x0D16
+#define GL_ZOOM_Y 0x0D17
+#define GL_GREEN_SCALE 0x0D18
+#define GL_GREEN_BIAS 0x0D19
+#define GL_BLUE_SCALE 0x0D1A
+#define GL_BLUE_BIAS 0x0D1B
+#define GL_ALPHA_SCALE 0x0D1C
+#define GL_ALPHA_BIAS 0x0D1D
+#define GL_DEPTH_SCALE 0x0D1E
+#define GL_DEPTH_BIAS 0x0D1F
+#define GL_MAX_EVAL_ORDER 0x0D30
+#define GL_MAX_LIGHTS 0x0D31
+#define GL_MAX_CLIP_PLANES 0x0D32
+#define GL_MAX_TEXTURE_SIZE 0x0D33
+#define GL_MAX_PIXEL_MAP_TABLE 0x0D34
+#define GL_SUBPIXEL_BITS 0x0D50
+#define GL_INDEX_BITS 0x0D51
+#define GL_RED_BITS 0x0D52
+#define GL_GREEN_BITS 0x0D53
+#define GL_BLUE_BITS 0x0D54
+#define GL_ALPHA_BITS 0x0D55
+#define GL_DEPTH_BITS 0x0D56
+#define GL_STENCIL_BITS 0x0D57
+#define GL_ACCUM_RED_BITS 0x0D58
+#define GL_ACCUM_GREEN_BITS 0x0D59
+#define GL_ACCUM_BLUE_BITS 0x0D5A
+#define GL_NAME_STACK_DEPTH 0x0D70
+#define GL_AUTO_NORMAL 0x0D80
+#define GL_MAP1_COLOR_4 0x0D90
+#define GL_MAP1_INDEX 0x0D91
+#define GL_MAP1_NORMAL 0x0D92
+#define GL_MAP1_TEXTURE_COORD_1 0x0D93
+#define GL_MAP1_TEXTURE_COORD_2 0x0D94
+#define GL_MAP1_TEXTURE_COORD_3 0x0D95
+#define GL_MAP1_TEXTURE_COORD_4 0x0D96
+#define GL_MAP1_VERTEX_3 0x0D97
+#define GL_MAP1_VERTEX_4 0x0D98
+#define GL_MAP2_COLOR_4 0x0DB0
+#define GL_MAP2_INDEX 0x0DB1
+#define GL_MAP2_NORMAL 0x0DB2
+#define GL_MAP2_TEXTURE_COORD_1 0x0DB3
+#define GL_MAP2_TEXTURE_COORD_2 0x0DB4
+#define GL_MAP2_TEXTURE_COORD_3 0x0DB5
+#define GL_MAP2_TEXTURE_COORD_4 0x0DB6
+#define GL_MAP2_VERTEX_3 0x0DB7
+#define GL_MAP2_VERTEX_4 0x0DB8
+#define GL_MAP1_GRID_DOMAIN 0x0DD0
+#define GL_MAP2_GRID_DOMAIN 0x0DD2
+#define GL_TEXTURE_1D 0x0DE0
+#define GL_TEXTURE_2D 0x0DE1
+#define GL_TEXTURE_WIDTH 0x1000
+#define GL_TRANSFORM_BIT 0x00001000
+#define GL_TEXTURE_HEIGHT 0x1001
+#define GL_TEXTURE_BORDER 0x1005
+#define GL_DONT_CARE 0x1100
+#define GL_FASTEST 0x1101
+#define GL_NICEST 0x1102
+#define GL_AMBIENT 0x1200
+#define GL_DIFFUSE 0x1201
+#define GL_SPECULAR 0x1202
+#define GL_POSITION 0x1203
+#define GL_SPOT_DIRECTION 0x1204
+#define GL_SPOT_EXPONENT 0x1205
+#define GL_SPOT_CUTOFF 0x1206
+#define GL_COMPILE 0x1300
+#define GL_COMPILE_AND_EXECUTE 0x1301
+#define GL_BYTE 0x1400
+#define GL_UNSIGNED_BYTE 0x1401
+#define GL_SHORT 0x1402
+#define GL_UNSIGNED_SHORT 0x1403
+#define GL_INT 0x1404
+#define GL_UNSIGNED_INT 0x1405
+#define GL_FLOAT 0x1406
+#define GL_2_BYTES 0x1407
+#define GL_3_BYTES 0x1408
+#define GL_4_BYTES 0x1409
+#define GL_DOUBLE 0x140A
+#define GL_CLEAR 0x1500
+#define GL_AND 0x1501
+#define GL_AND_REVERSE 0x1502
+#define GL_COPY 0x1503
+#define GL_AND_INVERTED 0x1504
+#define GL_NOOP 0x1505
+#define GL_XOR 0x1506
+#define GL_OR 0x1507
+#define GL_NOR 0x1508
+#define GL_EQUIV 0x1509
+#define GL_INVERT 0x150A
+#define GL_OR_REVERSE 0x150B
+#define GL_COPY_INVERTED 0x150C
+#define GL_OR_INVERTED 0x150D
+#define GL_NAND 0x150E
+#define GL_SET 0x150F
+#define GL_EMISSION 0x1600
+#define GL_SHININESS 0x1601
+#define GL_AMBIENT_AND_DIFFUSE 0x1602
+#define GL_COLOR_INDEXES 0x1603
+#define GL_MODELVIEW 0x1700
+#define GL_PROJECTION 0x1701
+#define GL_TEXTURE 0x1702
+#define GL_COLOR 0x1800
+#define GL_DEPTH 0x1801
+#define GL_STENCIL 0x1802
+#define GL_COLOR_INDEX 0x1900
+#define GL_STENCIL_INDEX 0x1901
+#define GL_DEPTH_COMPONENT 0x1902
+#define GL_RED 0x1903
+#define GL_GREEN 0x1904
+#define GL_BLUE 0x1905
+#define GL_ALPHA 0x1906
+#define GL_RGB 0x1907
+#define GL_RGBA 0x1908
+#define GL_LUMINANCE 0x1909
+#define GL_LUMINANCE_ALPHA 0x190A
+#define GL_BITMAP 0x1A00
+#define GL_POINT 0x1B00
+#define GL_LINE 0x1B01
+#define GL_FILL 0x1B02
+#define GL_RENDER 0x1C00
+#define GL_FEEDBACK 0x1C01
+#define GL_SELECT 0x1C02
+#define GL_FLAT 0x1D00
+#define GL_SMOOTH 0x1D01
+#define GL_KEEP 0x1E00
+#define GL_REPLACE 0x1E01
+#define GL_INCR 0x1E02
+#define GL_DECR 0x1E03
+#define GL_VENDOR 0x1F00
+#define GL_RENDERER 0x1F01
+#define GL_VERSION 0x1F02
+#define GL_EXTENSIONS 0x1F03
+#define GL_S 0x2000
+#define GL_ENABLE_BIT 0x00002000
+#define GL_T 0x2001
+#define GL_R 0x2002
+#define GL_Q 0x2003
+#define GL_MODULATE 0x2100
+#define GL_DECAL 0x2101
+#define GL_TEXTURE_ENV_MODE 0x2200
+#define GL_TEXTURE_ENV_COLOR 0x2201
+#define GL_TEXTURE_ENV 0x2300
+#define GL_EYE_LINEAR 0x2400
+#define GL_OBJECT_LINEAR 0x2401
+#define GL_SPHERE_MAP 0x2402
+#define GL_TEXTURE_GEN_MODE 0x2500
+#define GL_OBJECT_PLANE 0x2501
+#define GL_EYE_PLANE 0x2502
+#define GL_NEAREST 0x2600
+#define GL_LINEAR 0x2601
+#define GL_TEXTURE_MAG_FILTER 0x2800
+#define GL_TEXTURE_MIN_FILTER 0x2801
+#define GL_TEXTURE_WRAP_S 0x2802
+#define GL_TEXTURE_WRAP_T 0x2803
+#define GL_CLAMP 0x2900
+#define GL_REPEAT 0x2901
+#define GL_R3_G3_B2 0x2A10
+#define GL_V2F 0x2A20
+#define GL_V3F 0x2A21
+#define GL_C4UB_V2F 0x2A22
+#define GL_C4UB_V3F 0x2A23
+#define GL_C3F_V3F 0x2A24
+#define GL_N3F_V3F 0x2A25
+#define GL_C4F_N3F_V3F 0x2A26
+#define GL_T2F_V3F 0x2A27
+#define GL_T4F_V4F 0x2A28
+#define GL_T2F_C4UB_V3F 0x2A29
+#define GL_T2F_C3F_V3F 0x2A2A
+#define GL_T2F_N3F_V3F 0x2A2B
+#define GL_T2F_C4F_N3F_V3F 0x2A2C
+#define GL_T4F_C4F_N3F_V4F 0x2A2D
+#define GL_CLIP_PLANE0 0x3000
+#define GL_CLIP_PLANE1 0x3001
+#define GL_CLIP_PLANE2 0x3002
+#define GL_CLIP_PLANE3 0x3003
+#define GL_CLIP_PLANE4 0x3004
+#define GL_CLIP_PLANE5 0x3005
+#define GL_LIGHT0 0x4000
+#define GL_COLOR_BUFFER_BIT 0x00004000
+#define GL_LIGHT1 0x4001
+#define GL_LIGHT2 0x4002
+#define GL_LIGHT3 0x4003
+#define GL_LIGHT4 0x4004
+#define GL_LIGHT5 0x4005
+#define GL_LIGHT6 0x4006
+#define GL_LIGHT7 0x4007
+#define GL_HINT_BIT 0x00008000
+#define GL_POLYGON_OFFSET_FILL 0x8037
+#define GL_ALPHA4 0x803B
+#define GL_ALPHA8 0x803C
+#define GL_ALPHA12 0x803D
+#define GL_ALPHA16 0x803E
+#define GL_LUMINANCE4 0x803F
+#define GL_LUMINANCE8 0x8040
+#define GL_LUMINANCE12 0x8041
+#define GL_LUMINANCE16 0x8042
+#define GL_LUMINANCE4_ALPHA4 0x8043
+#define GL_LUMINANCE6_ALPHA2 0x8044
+#define GL_LUMINANCE8_ALPHA8 0x8045
+#define GL_LUMINANCE12_ALPHA4 0x8046
+#define GL_LUMINANCE12_ALPHA12 0x8047
+#define GL_LUMINANCE16_ALPHA16 0x8048
+#define GL_INTENSITY 0x8049
+#define GL_INTENSITY4 0x804A
+#define GL_INTENSITY8 0x804B
+#define GL_INTENSITY12 0x804C
+#define GL_INTENSITY16 0x804D
+#define GL_RGB4 0x804F
+#define GL_RGB5 0x8050
+#define GL_RGB8 0x8051
+#define GL_RGB10 0x8052
+#define GL_RGB12 0x8053
+#define GL_RGB16 0x8054
+#define GL_RGBA2 0x8055
+#define GL_RGBA4 0x8056
+#define GL_RGB5_A1 0x8057
+#define GL_RGBA8 0x8058
+#define GL_RGB10_A2 0x8059
+#define GL_RGBA12 0x805A
+#define GL_RGBA16 0x805B
+#define GL_TEXTURE_RED_SIZE 0x805C
+#define GL_TEXTURE_BLUE_SIZE 0x805E
+#define GL_PROXY_TEXTURE_1D 0x8063
+#define GL_PROXY_TEXTURE_2D 0x8064
+#define GL_TEXTURE_PRIORITY 0x8066
+#define GL_TEXTURE_RESIDENT 0x8067
+#define GL_TEXTURE_BINDING_1D 0x8068
+#define GL_TEXTURE_BINDING_2D 0x8069
+#define GL_VERTEX_ARRAY 0x8074
+#define GL_NORMAL_ARRAY 0x8075
+#define GL_COLOR_ARRAY 0x8076
+#define GL_INDEX_ARRAY 0x8077
+#define GL_TEXTURE_COORD_ARRAY 0x8078
+#define GL_EDGE_FLAG_ARRAY 0x8079
+#define GL_VERTEX_ARRAY_SIZE 0x807A
+#define GL_VERTEX_ARRAY_TYPE 0x807B
+#define GL_NORMAL_ARRAY_TYPE 0x807E
+#define GL_COLOR_ARRAY_SIZE 0x8081
+#define GL_COLOR_ARRAY_TYPE 0x8082
+#define GL_COLOR_ARRAY_STRIDE 0x8083
+#define GL_INDEX_ARRAY_TYPE 0x8085
+#define GL_INDEX_ARRAY_STRIDE 0x8086
+#define GL_COLOR_ARRAY_POINTER 0x8090
+#define GL_INDEX_ARRAY_POINTER 0x8091
+#define GL_COLOR_INDEX1_EXT 0x80E2
+#define GL_COLOR_INDEX2_EXT 0x80E3
+#define GL_COLOR_INDEX4_EXT 0x80E4
+#define GL_COLOR_INDEX8_EXT 0x80E5
+#define GL_COLOR_INDEX12_EXT 0x80E6
+#define GL_COLOR_INDEX16_EXT 0x80E7
+#define GL_EVAL_BIT 0x00010000
+#define GL_LIST_BIT 0x00020000
+#define GL_TEXTURE_BIT 0x00040000
+#define GL_SCISSOR_BIT 0x00080000
+#define GL_ALL_ATTRIB_BITS 0x000fffff
+#define GL_CLIENT_ALL_ATTRIB_BITS 0xffffffff
+GLAPI void GLAPIENTRY glAccum (GLenum op, GLfloat value);
+GLAPI void GLAPIENTRY glAlphaFunc (GLenum func, GLclampf ref);
+GLAPI GLboolean GLAPIENTRY glAreTexturesResident (GLsizei n, const GLuint *textures, GLboolean *residences);
+GLAPI void GLAPIENTRY glArrayElement (GLint i);
+GLAPI void GLAPIENTRY glBegin (GLenum mode);
+GLAPI void GLAPIENTRY glBindTexture (GLenum target, GLuint texture);
+GLAPI void GLAPIENTRY glBitmap (GLsizei width, GLsizei height, GLfloat xorig, GLfloat yorig, GLfloat xmove, GLfloat ymove, const GLubyte *bitmap);
+GLAPI void GLAPIENTRY glBlendFunc (GLenum sfactor, GLenum dfactor);
+GLAPI void GLAPIENTRY glCallList (GLuint list);
+GLAPI void GLAPIENTRY glCallLists (GLsizei n, GLenum type, const void *lists);
+GLAPI void GLAPIENTRY glClear (GLbitfield mask);
+GLAPI void GLAPIENTRY glClearAccum (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha);
+GLAPI void GLAPIENTRY glClearColor (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
+GLAPI void GLAPIENTRY glClearDepth (GLclampd depth);
+GLAPI void GLAPIENTRY glClearIndex (GLfloat c);
+GLAPI void GLAPIENTRY glClearStencil (GLint s);
+GLAPI void GLAPIENTRY glClipPlane (GLenum plane, const GLdouble *equation);
+GLAPI void GLAPIENTRY glColor3b (GLbyte red, GLbyte green, GLbyte blue);
+GLAPI void GLAPIENTRY glColor3bv (const GLbyte *v);
+GLAPI void GLAPIENTRY glColor3d (GLdouble red, GLdouble green, GLdouble blue);
+GLAPI void GLAPIENTRY glColor3dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glColor3f (GLfloat red, GLfloat green, GLfloat blue);
+GLAPI void GLAPIENTRY glColor3fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glColor3i (GLint red, GLint green, GLint blue);
+GLAPI void GLAPIENTRY glColor3iv (const GLint *v);
+GLAPI void GLAPIENTRY glColor3s (GLshort red, GLshort green, GLshort blue);
+GLAPI void GLAPIENTRY glColor3sv (const GLshort *v);
+GLAPI void GLAPIENTRY glColor3ub (GLubyte red, GLubyte green, GLubyte blue);
+GLAPI void GLAPIENTRY glColor3ubv (const GLubyte *v);
+GLAPI void GLAPIENTRY glColor3ui (GLuint red, GLuint green, GLuint blue);
+GLAPI void GLAPIENTRY glColor3uiv (const GLuint *v);
+GLAPI void GLAPIENTRY glColor3us (GLushort red, GLushort green, GLushort blue);
+GLAPI void GLAPIENTRY glColor3usv (const GLushort *v);
+GLAPI void GLAPIENTRY glColor4b (GLbyte red, GLbyte green, GLbyte blue, GLbyte alpha);
+GLAPI void GLAPIENTRY glColor4bv (const GLbyte *v);
+GLAPI void GLAPIENTRY glColor4d (GLdouble red, GLdouble green, GLdouble blue, GLdouble alpha);
+GLAPI void GLAPIENTRY glColor4dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glColor4f (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha);
+GLAPI void GLAPIENTRY glColor4fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glColor4i (GLint red, GLint green, GLint blue, GLint alpha);
+GLAPI void GLAPIENTRY glColor4iv (const GLint *v);
+GLAPI void GLAPIENTRY glColor4s (GLshort red, GLshort green, GLshort blue, GLshort alpha);
+GLAPI void GLAPIENTRY glColor4sv (const GLshort *v);
+GLAPI void GLAPIENTRY glColor4ub (GLubyte red, GLubyte green, GLubyte blue, GLubyte alpha);
+GLAPI void GLAPIENTRY glColor4ubv (const GLubyte *v);
+GLAPI void GLAPIENTRY glColor4ui (GLuint red, GLuint green, GLuint blue, GLuint alpha);
+GLAPI void GLAPIENTRY glColor4uiv (const GLuint *v);
+GLAPI void GLAPIENTRY glColor4us (GLushort red, GLushort green, GLushort blue, GLushort alpha);
+GLAPI void GLAPIENTRY glColor4usv (const GLushort *v);
+GLAPI void GLAPIENTRY glColorMask (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha);
+GLAPI void GLAPIENTRY glColorMaterial (GLenum face, GLenum mode);
+GLAPI void GLAPIENTRY glColorPointer (GLint size, GLenum type, GLsizei stride, const void *pointer);
+GLAPI void GLAPIENTRY glCopyPixels (GLint x, GLint y, GLsizei width, GLsizei height, GLenum type);
+GLAPI void GLAPIENTRY glCopyTexImage1D (GLenum target, GLint level, GLenum internalFormat, GLint x, GLint y, GLsizei width, GLint border);
+GLAPI void GLAPIENTRY glCopyTexImage2D (GLenum target, GLint level, GLenum internalFormat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border);
+GLAPI void GLAPIENTRY glCopyTexSubImage1D (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width);
+GLAPI void GLAPIENTRY glCopyTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+GLAPI void GLAPIENTRY glCullFace (GLenum mode);
+GLAPI void GLAPIENTRY glDeleteLists (GLuint list, GLsizei range);
+GLAPI void GLAPIENTRY glDeleteTextures (GLsizei n, const GLuint *textures);
+GLAPI void GLAPIENTRY glDepthFunc (GLenum func);
+GLAPI void GLAPIENTRY glDepthMask (GLboolean flag);
+GLAPI void GLAPIENTRY glDepthRange (GLclampd zNear, GLclampd zFar);
+GLAPI void GLAPIENTRY glDisable (GLenum cap);
+GLAPI void GLAPIENTRY glDisableClientState (GLenum array);
+GLAPI void GLAPIENTRY glDrawArrays (GLenum mode, GLint first, GLsizei count);
+GLAPI void GLAPIENTRY glDrawBuffer (GLenum mode);
+GLAPI void GLAPIENTRY glDrawElements (GLenum mode, GLsizei count, GLenum type, const void *indices);
+GLAPI void GLAPIENTRY glDrawPixels (GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels);
+GLAPI void GLAPIENTRY glEdgeFlag (GLboolean flag);
+GLAPI void GLAPIENTRY glEdgeFlagPointer (GLsizei stride, const void *pointer);
+GLAPI void GLAPIENTRY glEdgeFlagv (const GLboolean *flag);
+GLAPI void GLAPIENTRY glEnable (GLenum cap);
+GLAPI void GLAPIENTRY glEnableClientState (GLenum array);
+GLAPI void GLAPIENTRY glEnd (void);
+GLAPI void GLAPIENTRY glEndList (void);
+GLAPI void GLAPIENTRY glEvalCoord1d (GLdouble u);
+GLAPI void GLAPIENTRY glEvalCoord1dv (const GLdouble *u);
+GLAPI void GLAPIENTRY glEvalCoord1f (GLfloat u);
+GLAPI void GLAPIENTRY glEvalCoord1fv (const GLfloat *u);
+GLAPI void GLAPIENTRY glEvalCoord2d (GLdouble u, GLdouble v);
+GLAPI void GLAPIENTRY glEvalCoord2dv (const GLdouble *u);
+GLAPI void GLAPIENTRY glEvalCoord2f (GLfloat u, GLfloat v);
+GLAPI void GLAPIENTRY glEvalCoord2fv (const GLfloat *u);
+GLAPI void GLAPIENTRY glEvalMesh1 (GLenum mode, GLint i1, GLint i2);
+GLAPI void GLAPIENTRY glEvalMesh2 (GLenum mode, GLint i1, GLint i2, GLint j1, GLint j2);
+GLAPI void GLAPIENTRY glEvalPoint1 (GLint i);
+GLAPI void GLAPIENTRY glEvalPoint2 (GLint i, GLint j);
+GLAPI void GLAPIENTRY glFeedbackBuffer (GLsizei size, GLenum type, GLfloat *buffer);
+GLAPI void GLAPIENTRY glFinish (void);
+GLAPI void GLAPIENTRY glFlush (void);
+GLAPI void GLAPIENTRY glFogf (GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glFogfv (GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glFogi (GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glFogiv (GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glFrontFace (GLenum mode);
+GLAPI void GLAPIENTRY glFrustum (GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar);
+GLAPI GLuint GLAPIENTRY glGenLists (GLsizei range);
+GLAPI void GLAPIENTRY glGenTextures (GLsizei n, GLuint *textures);
+GLAPI void GLAPIENTRY glGetBooleanv (GLenum pname, GLboolean *params);
+GLAPI void GLAPIENTRY glGetClipPlane (GLenum plane, GLdouble *equation);
+GLAPI void GLAPIENTRY glGetDoublev (GLenum pname, GLdouble *params);
+GLAPI GLenum GLAPIENTRY glGetError (void);
+GLAPI void GLAPIENTRY glGetFloatv (GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetIntegerv (GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetLightfv (GLenum light, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetLightiv (GLenum light, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetMapdv (GLenum target, GLenum query, GLdouble *v);
+GLAPI void GLAPIENTRY glGetMapfv (GLenum target, GLenum query, GLfloat *v);
+GLAPI void GLAPIENTRY glGetMapiv (GLenum target, GLenum query, GLint *v);
+GLAPI void GLAPIENTRY glGetMaterialfv (GLenum face, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetMaterialiv (GLenum face, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetPixelMapfv (GLenum map, GLfloat *values);
+GLAPI void GLAPIENTRY glGetPixelMapuiv (GLenum map, GLuint *values);
+GLAPI void GLAPIENTRY glGetPixelMapusv (GLenum map, GLushort *values);
+GLAPI void GLAPIENTRY glGetPointerv (GLenum pname, void* *params);
+GLAPI void GLAPIENTRY glGetPolygonStipple (GLubyte *mask);
+GLAPI const GLubyte * GLAPIENTRY glGetString (GLenum name);
+GLAPI void GLAPIENTRY glGetTexEnvfv (GLenum target, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetTexEnviv (GLenum target, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetTexGendv (GLenum coord, GLenum pname, GLdouble *params);
+GLAPI void GLAPIENTRY glGetTexGenfv (GLenum coord, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetTexGeniv (GLenum coord, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetTexImage (GLenum target, GLint level, GLenum format, GLenum type, void *pixels);
+GLAPI void GLAPIENTRY glGetTexLevelParameterfv (GLenum target, GLint level, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetTexLevelParameteriv (GLenum target, GLint level, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetTexParameterfv (GLenum target, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetTexParameteriv (GLenum target, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glHint (GLenum target, GLenum mode);
+GLAPI void GLAPIENTRY glIndexMask (GLuint mask);
+GLAPI void GLAPIENTRY glIndexPointer (GLenum type, GLsizei stride, const void *pointer);
+GLAPI void GLAPIENTRY glIndexd (GLdouble c);
+GLAPI void GLAPIENTRY glIndexdv (const GLdouble *c);
+GLAPI void GLAPIENTRY glIndexf (GLfloat c);
+GLAPI void GLAPIENTRY glIndexfv (const GLfloat *c);
+GLAPI void GLAPIENTRY glIndexi (GLint c);
+GLAPI void GLAPIENTRY glIndexiv (const GLint *c);
+GLAPI void GLAPIENTRY glIndexs (GLshort c);
+GLAPI void GLAPIENTRY glIndexsv (const GLshort *c);
+GLAPI void GLAPIENTRY glIndexub (GLubyte c);
+GLAPI void GLAPIENTRY glIndexubv (const GLubyte *c);
+GLAPI void GLAPIENTRY glInitNames (void);
+GLAPI void GLAPIENTRY glInterleavedArrays (GLenum format, GLsizei stride, const void *pointer);
+GLAPI GLboolean GLAPIENTRY glIsEnabled (GLenum cap);
+GLAPI GLboolean GLAPIENTRY glIsList (GLuint list);
+GLAPI GLboolean GLAPIENTRY glIsTexture (GLuint texture);
+GLAPI void GLAPIENTRY glLightModelf (GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glLightModelfv (GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glLightModeli (GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glLightModeliv (GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glLightf (GLenum light, GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glLightfv (GLenum light, GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glLighti (GLenum light, GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glLightiv (GLenum light, GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glLineStipple (GLint factor, GLushort pattern);
+GLAPI void GLAPIENTRY glLineWidth (GLfloat width);
+GLAPI void GLAPIENTRY glListBase (GLuint base);
+GLAPI void GLAPIENTRY glLoadIdentity (void);
+GLAPI void GLAPIENTRY glLoadMatrixd (const GLdouble *m);
+GLAPI void GLAPIENTRY glLoadMatrixf (const GLfloat *m);
+GLAPI void GLAPIENTRY glLoadName (GLuint name);
+GLAPI void GLAPIENTRY glLogicOp (GLenum opcode);
+GLAPI void GLAPIENTRY glMap1d (GLenum target, GLdouble u1, GLdouble u2, GLint stride, GLint order, const GLdouble *points);
+GLAPI void GLAPIENTRY glMap1f (GLenum target, GLfloat u1, GLfloat u2, GLint stride, GLint order, const GLfloat *points);
+GLAPI void GLAPIENTRY glMap2d (GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, const GLdouble *points);
+GLAPI void GLAPIENTRY glMap2f (GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, const GLfloat *points);
+GLAPI void GLAPIENTRY glMapGrid1d (GLint un, GLdouble u1, GLdouble u2);
+GLAPI void GLAPIENTRY glMapGrid1f (GLint un, GLfloat u1, GLfloat u2);
+GLAPI void GLAPIENTRY glMapGrid2d (GLint un, GLdouble u1, GLdouble u2, GLint vn, GLdouble v1, GLdouble v2);
+GLAPI void GLAPIENTRY glMapGrid2f (GLint un, GLfloat u1, GLfloat u2, GLint vn, GLfloat v1, GLfloat v2);
+GLAPI void GLAPIENTRY glMaterialf (GLenum face, GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glMaterialfv (GLenum face, GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glMateriali (GLenum face, GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glMaterialiv (GLenum face, GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glMatrixMode (GLenum mode);
+GLAPI void GLAPIENTRY glMultMatrixd (const GLdouble *m);
+GLAPI void GLAPIENTRY glMultMatrixf (const GLfloat *m);
+GLAPI void GLAPIENTRY glNewList (GLuint list, GLenum mode);
+GLAPI void GLAPIENTRY glNormal3b (GLbyte nx, GLbyte ny, GLbyte nz);
+GLAPI void GLAPIENTRY glNormal3bv (const GLbyte *v);
+GLAPI void GLAPIENTRY glNormal3d (GLdouble nx, GLdouble ny, GLdouble nz);
+GLAPI void GLAPIENTRY glNormal3dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glNormal3f (GLfloat nx, GLfloat ny, GLfloat nz);
+GLAPI void GLAPIENTRY glNormal3fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glNormal3i (GLint nx, GLint ny, GLint nz);
+GLAPI void GLAPIENTRY glNormal3iv (const GLint *v);
+GLAPI void GLAPIENTRY glNormal3s (GLshort nx, GLshort ny, GLshort nz);
+GLAPI void GLAPIENTRY glNormal3sv (const GLshort *v);
+GLAPI void GLAPIENTRY glNormalPointer (GLenum type, GLsizei stride, const void *pointer);
+GLAPI void GLAPIENTRY glOrtho (GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar);
+GLAPI void GLAPIENTRY glPassThrough (GLfloat token);
+GLAPI void GLAPIENTRY glPixelMapfv (GLenum map, GLsizei mapsize, const GLfloat *values);
+GLAPI void GLAPIENTRY glPixelMapuiv (GLenum map, GLsizei mapsize, const GLuint *values);
+GLAPI void GLAPIENTRY glPixelMapusv (GLenum map, GLsizei mapsize, const GLushort *values);
+GLAPI void GLAPIENTRY glPixelStoref (GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glPixelStorei (GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glPixelTransferf (GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glPixelTransferi (GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glPixelZoom (GLfloat xfactor, GLfloat yfactor);
+GLAPI void GLAPIENTRY glPointSize (GLfloat size);
+GLAPI void GLAPIENTRY glPolygonMode (GLenum face, GLenum mode);
+GLAPI void GLAPIENTRY glPolygonOffset (GLfloat factor, GLfloat units);
+GLAPI void GLAPIENTRY glPolygonStipple (const GLubyte *mask);
+GLAPI void GLAPIENTRY glPopAttrib (void);
+GLAPI void GLAPIENTRY glPopClientAttrib (void);
+GLAPI void GLAPIENTRY glPopMatrix (void);
+GLAPI void GLAPIENTRY glPopName (void);
+GLAPI void GLAPIENTRY glPrioritizeTextures (GLsizei n, const GLuint *textures, const GLclampf *priorities);
+GLAPI void GLAPIENTRY glPushAttrib (GLbitfield mask);
+GLAPI void GLAPIENTRY glPushClientAttrib (GLbitfield mask);
+GLAPI void GLAPIENTRY glPushMatrix (void);
+GLAPI void GLAPIENTRY glPushName (GLuint name);
+GLAPI void GLAPIENTRY glRasterPos2d (GLdouble x, GLdouble y);
+GLAPI void GLAPIENTRY glRasterPos2dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glRasterPos2f (GLfloat x, GLfloat y);
+GLAPI void GLAPIENTRY glRasterPos2fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glRasterPos2i (GLint x, GLint y);
+GLAPI void GLAPIENTRY glRasterPos2iv (const GLint *v);
+GLAPI void GLAPIENTRY glRasterPos2s (GLshort x, GLshort y);
+GLAPI void GLAPIENTRY glRasterPos2sv (const GLshort *v);
+GLAPI void GLAPIENTRY glRasterPos3d (GLdouble x, GLdouble y, GLdouble z);
+GLAPI void GLAPIENTRY glRasterPos3dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glRasterPos3f (GLfloat x, GLfloat y, GLfloat z);
+GLAPI void GLAPIENTRY glRasterPos3fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glRasterPos3i (GLint x, GLint y, GLint z);
+GLAPI void GLAPIENTRY glRasterPos3iv (const GLint *v);
+GLAPI void GLAPIENTRY glRasterPos3s (GLshort x, GLshort y, GLshort z);
+GLAPI void GLAPIENTRY glRasterPos3sv (const GLshort *v);
+GLAPI void GLAPIENTRY glRasterPos4d (GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+GLAPI void GLAPIENTRY glRasterPos4dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glRasterPos4f (GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+GLAPI void GLAPIENTRY glRasterPos4fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glRasterPos4i (GLint x, GLint y, GLint z, GLint w);
+GLAPI void GLAPIENTRY glRasterPos4iv (const GLint *v);
+GLAPI void GLAPIENTRY glRasterPos4s (GLshort x, GLshort y, GLshort z, GLshort w);
+GLAPI void GLAPIENTRY glRasterPos4sv (const GLshort *v);
+GLAPI void GLAPIENTRY glReadBuffer (GLenum mode);
+GLAPI void GLAPIENTRY glReadPixels (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, void *pixels);
+GLAPI void GLAPIENTRY glRectd (GLdouble x1, GLdouble y1, GLdouble x2, GLdouble y2);
+GLAPI void GLAPIENTRY glRectdv (const GLdouble *v1, const GLdouble *v2);
+GLAPI void GLAPIENTRY glRectf (GLfloat x1, GLfloat y1, GLfloat x2, GLfloat y2);
+GLAPI void GLAPIENTRY glRectfv (const GLfloat *v1, const GLfloat *v2);
+GLAPI void GLAPIENTRY glRecti (GLint x1, GLint y1, GLint x2, GLint y2);
+GLAPI void GLAPIENTRY glRectiv (const GLint *v1, const GLint *v2);
+GLAPI void GLAPIENTRY glRects (GLshort x1, GLshort y1, GLshort x2, GLshort y2);
+GLAPI void GLAPIENTRY glRectsv (const GLshort *v1, const GLshort *v2);
+GLAPI GLint GLAPIENTRY glRenderMode (GLenum mode);
+GLAPI void GLAPIENTRY glRotated (GLdouble angle, GLdouble x, GLdouble y, GLdouble z);
+GLAPI void GLAPIENTRY glRotatef (GLfloat angle, GLfloat x, GLfloat y, GLfloat z);
+GLAPI void GLAPIENTRY glScaled (GLdouble x, GLdouble y, GLdouble z);
+GLAPI void GLAPIENTRY glScalef (GLfloat x, GLfloat y, GLfloat z);
+GLAPI void GLAPIENTRY glScissor (GLint x, GLint y, GLsizei width, GLsizei height);
+GLAPI void GLAPIENTRY glSelectBuffer (GLsizei size, GLuint *buffer);
+GLAPI void GLAPIENTRY glShadeModel (GLenum mode);
+GLAPI void GLAPIENTRY glStencilFunc (GLenum func, GLint ref, GLuint mask);
+GLAPI void GLAPIENTRY glStencilMask (GLuint mask);
+GLAPI void GLAPIENTRY glStencilOp (GLenum fail, GLenum zfail, GLenum zpass);
+GLAPI void GLAPIENTRY glTexCoord1d (GLdouble s);
+GLAPI void GLAPIENTRY glTexCoord1dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glTexCoord1f (GLfloat s);
+GLAPI void GLAPIENTRY glTexCoord1fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glTexCoord1i (GLint s);
+GLAPI void GLAPIENTRY glTexCoord1iv (const GLint *v);
+GLAPI void GLAPIENTRY glTexCoord1s (GLshort s);
+GLAPI void GLAPIENTRY glTexCoord1sv (const GLshort *v);
+GLAPI void GLAPIENTRY glTexCoord2d (GLdouble s, GLdouble t);
+GLAPI void GLAPIENTRY glTexCoord2dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glTexCoord2f (GLfloat s, GLfloat t);
+GLAPI void GLAPIENTRY glTexCoord2fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glTexCoord2i (GLint s, GLint t);
+GLAPI void GLAPIENTRY glTexCoord2iv (const GLint *v);
+GLAPI void GLAPIENTRY glTexCoord2s (GLshort s, GLshort t);
+GLAPI void GLAPIENTRY glTexCoord2sv (const GLshort *v);
+GLAPI void GLAPIENTRY glTexCoord3d (GLdouble s, GLdouble t, GLdouble r);
+GLAPI void GLAPIENTRY glTexCoord3dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glTexCoord3f (GLfloat s, GLfloat t, GLfloat r);
+GLAPI void GLAPIENTRY glTexCoord3fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glTexCoord3i (GLint s, GLint t, GLint r);
+GLAPI void GLAPIENTRY glTexCoord3iv (const GLint *v);
+GLAPI void GLAPIENTRY glTexCoord3s (GLshort s, GLshort t, GLshort r);
+GLAPI void GLAPIENTRY glTexCoord3sv (const GLshort *v);
+GLAPI void GLAPIENTRY glTexCoord4d (GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+GLAPI void GLAPIENTRY glTexCoord4dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glTexCoord4f (GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+GLAPI void GLAPIENTRY glTexCoord4fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glTexCoord4i (GLint s, GLint t, GLint r, GLint q);
+GLAPI void GLAPIENTRY glTexCoord4iv (const GLint *v);
+GLAPI void GLAPIENTRY glTexCoord4s (GLshort s, GLshort t, GLshort r, GLshort q);
+GLAPI void GLAPIENTRY glTexCoord4sv (const GLshort *v);
+GLAPI void GLAPIENTRY glTexCoordPointer (GLint size, GLenum type, GLsizei stride, const void *pointer);
+GLAPI void GLAPIENTRY glTexEnvf (GLenum target, GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glTexEnvfv (GLenum target, GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glTexEnvi (GLenum target, GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glTexEnviv (GLenum target, GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glTexGend (GLenum coord, GLenum pname, GLdouble param);
+GLAPI void GLAPIENTRY glTexGendv (GLenum coord, GLenum pname, const GLdouble *params);
+GLAPI void GLAPIENTRY glTexGenf (GLenum coord, GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glTexGenfv (GLenum coord, GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glTexGeni (GLenum coord, GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glTexGeniv (GLenum coord, GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glTexImage1D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels);
+GLAPI void GLAPIENTRY glTexImage2D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels);
+GLAPI void GLAPIENTRY glTexParameterf (GLenum target, GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glTexParameterfv (GLenum target, GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glTexParameteri (GLenum target, GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glTexParameteriv (GLenum target, GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glTexSubImage1D (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels);
+GLAPI void GLAPIENTRY glTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels);
+GLAPI void GLAPIENTRY glTranslated (GLdouble x, GLdouble y, GLdouble z);
+GLAPI void GLAPIENTRY glTranslatef (GLfloat x, GLfloat y, GLfloat z);
+GLAPI void GLAPIENTRY glVertex2d (GLdouble x, GLdouble y);
+GLAPI void GLAPIENTRY glVertex2dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glVertex2f (GLfloat x, GLfloat y);
+GLAPI void GLAPIENTRY glVertex2fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glVertex2i (GLint x, GLint y);
+GLAPI void GLAPIENTRY glVertex2iv (const GLint *v);
+GLAPI void GLAPIENTRY glVertex2s (GLshort x, GLshort y);
+GLAPI void GLAPIENTRY glVertex2sv (const GLshort *v);
+GLAPI void GLAPIENTRY glVertex3d (GLdouble x, GLdouble y, GLdouble z);
+GLAPI void GLAPIENTRY glVertex3dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glVertex3f (GLfloat x, GLfloat y, GLfloat z);
+GLAPI void GLAPIENTRY glVertex3fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glVertex3i (GLint x, GLint y, GLint z);
+GLAPI void GLAPIENTRY glVertex3iv (const GLint *v);
+GLAPI void GLAPIENTRY glVertex3s (GLshort x, GLshort y, GLshort z);
+GLAPI void GLAPIENTRY glVertex3sv (const GLshort *v);
+GLAPI void GLAPIENTRY glVertex4d (GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+GLAPI void GLAPIENTRY glVertex4dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glVertex4f (GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+GLAPI void GLAPIENTRY glVertex4fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glVertex4i (GLint x, GLint y, GLint z, GLint w);
+GLAPI void GLAPIENTRY glVertex4iv (const GLint *v);
+GLAPI void GLAPIENTRY glVertex4s (GLshort x, GLshort y, GLshort z, GLshort w);
+GLAPI void GLAPIENTRY glVertex4sv (const GLshort *v);
+GLAPI void GLAPIENTRY glVertexPointer (GLint size, GLenum type, GLsizei stride, const void *pointer);
+GLAPI void GLAPIENTRY glViewport (GLint x, GLint y, GLsizei width, GLsizei height);
+#endif /* GL_VERSION_1_1 */
+/* ---------------------------------- GLU ---------------------------------- */
+#ifndef GLEW_NO_GLU
+# ifdef __APPLE__
+# include <Availability.h>
+# define GLEW_NO_GLU
+# endif
+# endif
+#ifndef GLEW_NO_GLU
+/* this is where we can safely include GLU */
+# if defined(__APPLE__) && defined(__MACH__)
+# include <OpenGL/glu.h>
+# else
+# include <GL/glu.h>
+# endif
+/* ----------------------------- GL_VERSION_1_2 ---------------------------- */
+#ifndef GL_VERSION_1_2
+#define GL_VERSION_1_2 1
+#define GL_UNSIGNED_BYTE_3_3_2 0x8032
+#define GL_UNSIGNED_SHORT_4_4_4_4 0x8033
+#define GL_UNSIGNED_SHORT_5_5_5_1 0x8034
+#define GL_UNSIGNED_INT_8_8_8_8 0x8035
+#define GL_UNSIGNED_INT_10_10_10_2 0x8036
+#define GL_RESCALE_NORMAL 0x803A
+#define GL_TEXTURE_BINDING_3D 0x806A
+#define GL_PACK_SKIP_IMAGES 0x806B
+#define GL_PACK_IMAGE_HEIGHT 0x806C
+#define GL_TEXTURE_3D 0x806F
+#define GL_PROXY_TEXTURE_3D 0x8070
+#define GL_TEXTURE_DEPTH 0x8071
+#define GL_TEXTURE_WRAP_R 0x8072
+#define GL_MAX_3D_TEXTURE_SIZE 0x8073
+#define GL_BGR 0x80E0
+#define GL_BGRA 0x80E1
+#define GL_CLAMP_TO_EDGE 0x812F
+#define GL_TEXTURE_MIN_LOD 0x813A
+#define GL_TEXTURE_MAX_LOD 0x813B
+#define GL_TEXTURE_MAX_LEVEL 0x813D
+#define GL_SINGLE_COLOR 0x81F9
+#define GL_UNSIGNED_BYTE_2_3_3_REV 0x8362
+#define GL_UNSIGNED_SHORT_5_6_5 0x8363
+#define GL_UNSIGNED_SHORT_5_6_5_REV 0x8364
+#define GL_UNSIGNED_SHORT_4_4_4_4_REV 0x8365
+#define GL_UNSIGNED_SHORT_1_5_5_5_REV 0x8366
+#define GL_UNSIGNED_INT_8_8_8_8_REV 0x8367
+typedef void (GLAPIENTRY * PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices);
+typedef void (GLAPIENTRY * PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels);
+#define glCopyTexSubImage3D GLEW_GET_FUN(__glewCopyTexSubImage3D)
+#define glDrawRangeElements GLEW_GET_FUN(__glewDrawRangeElements)
+#define glTexImage3D GLEW_GET_FUN(__glewTexImage3D)
+#define glTexSubImage3D GLEW_GET_FUN(__glewTexSubImage3D)
+#endif /* GL_VERSION_1_2 */
+/* ---------------------------- GL_VERSION_1_2_1 --------------------------- */
+#ifndef GL_VERSION_1_2_1
+#define GL_VERSION_1_2_1 1
+#endif /* GL_VERSION_1_2_1 */
+/* ----------------------------- GL_VERSION_1_3 ---------------------------- */
+#ifndef GL_VERSION_1_3
+#define GL_VERSION_1_3 1
+#define GL_MULTISAMPLE 0x809D
+#define GL_SAMPLE_ALPHA_TO_ONE 0x809F
+#define GL_SAMPLE_COVERAGE 0x80A0
+#define GL_SAMPLE_BUFFERS 0x80A8
+#define GL_SAMPLES 0x80A9
+#define GL_CLAMP_TO_BORDER 0x812D
+#define GL_TEXTURE0 0x84C0
+#define GL_TEXTURE1 0x84C1
+#define GL_TEXTURE2 0x84C2
+#define GL_TEXTURE3 0x84C3
+#define GL_TEXTURE4 0x84C4
+#define GL_TEXTURE5 0x84C5
+#define GL_TEXTURE6 0x84C6
+#define GL_TEXTURE7 0x84C7
+#define GL_TEXTURE8 0x84C8
+#define GL_TEXTURE9 0x84C9
+#define GL_TEXTURE10 0x84CA
+#define GL_TEXTURE11 0x84CB
+#define GL_TEXTURE12 0x84CC
+#define GL_TEXTURE13 0x84CD
+#define GL_TEXTURE14 0x84CE
+#define GL_TEXTURE15 0x84CF
+#define GL_TEXTURE16 0x84D0
+#define GL_TEXTURE17 0x84D1
+#define GL_TEXTURE18 0x84D2
+#define GL_TEXTURE19 0x84D3
+#define GL_TEXTURE20 0x84D4
+#define GL_TEXTURE21 0x84D5
+#define GL_TEXTURE22 0x84D6
+#define GL_TEXTURE23 0x84D7
+#define GL_TEXTURE24 0x84D8
+#define GL_TEXTURE25 0x84D9
+#define GL_TEXTURE26 0x84DA
+#define GL_TEXTURE27 0x84DB
+#define GL_TEXTURE28 0x84DC
+#define GL_TEXTURE29 0x84DD
+#define GL_TEXTURE30 0x84DE
+#define GL_TEXTURE31 0x84DF
+#define GL_ACTIVE_TEXTURE 0x84E0
+#define GL_MAX_TEXTURE_UNITS 0x84E2
+#define GL_SUBTRACT 0x84E7
+#define GL_NORMAL_MAP 0x8511
+#define GL_REFLECTION_MAP 0x8512
+#define GL_TEXTURE_CUBE_MAP 0x8513
+#define GL_COMBINE 0x8570
+#define GL_COMBINE_RGB 0x8571
+#define GL_COMBINE_ALPHA 0x8572
+#define GL_RGB_SCALE 0x8573
+#define GL_ADD_SIGNED 0x8574
+#define GL_INTERPOLATE 0x8575
+#define GL_CONSTANT 0x8576
+#define GL_PRIMARY_COLOR 0x8577
+#define GL_PREVIOUS 0x8578
+#define GL_SOURCE0_RGB 0x8580
+#define GL_SOURCE1_RGB 0x8581
+#define GL_SOURCE2_RGB 0x8582
+#define GL_SOURCE0_ALPHA 0x8588
+#define GL_SOURCE1_ALPHA 0x8589
+#define GL_SOURCE2_ALPHA 0x858A
+#define GL_OPERAND0_RGB 0x8590
+#define GL_OPERAND1_RGB 0x8591
+#define GL_OPERAND2_RGB 0x8592
+#define GL_OPERAND0_ALPHA 0x8598
+#define GL_OPERAND1_ALPHA 0x8599
+#define GL_OPERAND2_ALPHA 0x859A
+#define GL_DOT3_RGB 0x86AE
+#define GL_DOT3_RGBA 0x86AF
+#define GL_MULTISAMPLE_BIT 0x20000000
+typedef void (GLAPIENTRY * PFNGLACTIVETEXTUREPROC) (GLenum texture);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint lod, void *img);
+typedef void (GLAPIENTRY * PFNGLLOADTRANSPOSEMATRIXDPROC) (const GLdouble m[16]);
+typedef void (GLAPIENTRY * PFNGLMULTTRANSPOSEMATRIXDPROC) (const GLdouble m[16]);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1FPROC) (GLenum target, GLfloat s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1FVPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1IPROC) (GLenum target, GLint s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1IVPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1SPROC) (GLenum target, GLshort s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1SVPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2DPROC) (GLenum target, GLdouble s, GLdouble t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2DVPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2FPROC) (GLenum target, GLfloat s, GLfloat t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2FVPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2IPROC) (GLenum target, GLint s, GLint t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2IVPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2SPROC) (GLenum target, GLshort s, GLshort t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2SVPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3DVPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3FVPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3IPROC) (GLenum target, GLint s, GLint t, GLint r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3IVPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3SPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3SVPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4DVPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4FVPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4IPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4IVPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4SPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4SVPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLSAMPLECOVERAGEPROC) (GLclampf value, GLboolean invert);
+#define glActiveTexture GLEW_GET_FUN(__glewActiveTexture)
+#define glClientActiveTexture GLEW_GET_FUN(__glewClientActiveTexture)
+#define glCompressedTexImage1D GLEW_GET_FUN(__glewCompressedTexImage1D)
+#define glCompressedTexImage2D GLEW_GET_FUN(__glewCompressedTexImage2D)
+#define glCompressedTexImage3D GLEW_GET_FUN(__glewCompressedTexImage3D)
+#define glCompressedTexSubImage1D GLEW_GET_FUN(__glewCompressedTexSubImage1D)
+#define glCompressedTexSubImage2D GLEW_GET_FUN(__glewCompressedTexSubImage2D)
+#define glCompressedTexSubImage3D GLEW_GET_FUN(__glewCompressedTexSubImage3D)
+#define glGetCompressedTexImage GLEW_GET_FUN(__glewGetCompressedTexImage)
+#define glLoadTransposeMatrixd GLEW_GET_FUN(__glewLoadTransposeMatrixd)
+#define glLoadTransposeMatrixf GLEW_GET_FUN(__glewLoadTransposeMatrixf)
+#define glMultTransposeMatrixd GLEW_GET_FUN(__glewMultTransposeMatrixd)
+#define glMultTransposeMatrixf GLEW_GET_FUN(__glewMultTransposeMatrixf)
+#define glMultiTexCoord1d GLEW_GET_FUN(__glewMultiTexCoord1d)
+#define glMultiTexCoord1dv GLEW_GET_FUN(__glewMultiTexCoord1dv)
+#define glMultiTexCoord1f GLEW_GET_FUN(__glewMultiTexCoord1f)
+#define glMultiTexCoord1fv GLEW_GET_FUN(__glewMultiTexCoord1fv)
+#define glMultiTexCoord1i GLEW_GET_FUN(__glewMultiTexCoord1i)
+#define glMultiTexCoord1iv GLEW_GET_FUN(__glewMultiTexCoord1iv)
+#define glMultiTexCoord1s GLEW_GET_FUN(__glewMultiTexCoord1s)
+#define glMultiTexCoord1sv GLEW_GET_FUN(__glewMultiTexCoord1sv)
+#define glMultiTexCoord2d GLEW_GET_FUN(__glewMultiTexCoord2d)
+#define glMultiTexCoord2dv GLEW_GET_FUN(__glewMultiTexCoord2dv)
+#define glMultiTexCoord2f GLEW_GET_FUN(__glewMultiTexCoord2f)
+#define glMultiTexCoord2fv GLEW_GET_FUN(__glewMultiTexCoord2fv)
+#define glMultiTexCoord2i GLEW_GET_FUN(__glewMultiTexCoord2i)
+#define glMultiTexCoord2iv GLEW_GET_FUN(__glewMultiTexCoord2iv)
+#define glMultiTexCoord2s GLEW_GET_FUN(__glewMultiTexCoord2s)
+#define glMultiTexCoord2sv GLEW_GET_FUN(__glewMultiTexCoord2sv)
+#define glMultiTexCoord3d GLEW_GET_FUN(__glewMultiTexCoord3d)
+#define glMultiTexCoord3dv GLEW_GET_FUN(__glewMultiTexCoord3dv)
+#define glMultiTexCoord3f GLEW_GET_FUN(__glewMultiTexCoord3f)
+#define glMultiTexCoord3fv GLEW_GET_FUN(__glewMultiTexCoord3fv)
+#define glMultiTexCoord3i GLEW_GET_FUN(__glewMultiTexCoord3i)
+#define glMultiTexCoord3iv GLEW_GET_FUN(__glewMultiTexCoord3iv)
+#define glMultiTexCoord3s GLEW_GET_FUN(__glewMultiTexCoord3s)
+#define glMultiTexCoord3sv GLEW_GET_FUN(__glewMultiTexCoord3sv)
+#define glMultiTexCoord4d GLEW_GET_FUN(__glewMultiTexCoord4d)
+#define glMultiTexCoord4dv GLEW_GET_FUN(__glewMultiTexCoord4dv)
+#define glMultiTexCoord4f GLEW_GET_FUN(__glewMultiTexCoord4f)
+#define glMultiTexCoord4fv GLEW_GET_FUN(__glewMultiTexCoord4fv)
+#define glMultiTexCoord4i GLEW_GET_FUN(__glewMultiTexCoord4i)
+#define glMultiTexCoord4iv GLEW_GET_FUN(__glewMultiTexCoord4iv)
+#define glMultiTexCoord4s GLEW_GET_FUN(__glewMultiTexCoord4s)
+#define glMultiTexCoord4sv GLEW_GET_FUN(__glewMultiTexCoord4sv)
+#define glSampleCoverage GLEW_GET_FUN(__glewSampleCoverage)
+#endif /* GL_VERSION_1_3 */
+/* ----------------------------- GL_VERSION_1_4 ---------------------------- */
+#ifndef GL_VERSION_1_4
+#define GL_VERSION_1_4 1
+#define GL_BLEND_DST_RGB 0x80C8
+#define GL_BLEND_SRC_RGB 0x80C9
+#define GL_BLEND_DST_ALPHA 0x80CA
+#define GL_BLEND_SRC_ALPHA 0x80CB
+#define GL_POINT_SIZE_MIN 0x8126
+#define GL_POINT_SIZE_MAX 0x8127
+#define GL_GENERATE_MIPMAP 0x8191
+#define GL_DEPTH_COMPONENT16 0x81A5
+#define GL_DEPTH_COMPONENT24 0x81A6
+#define GL_DEPTH_COMPONENT32 0x81A7
+#define GL_MIRRORED_REPEAT 0x8370
+#define GL_FOG_COORDINATE 0x8451
+#define GL_FRAGMENT_DEPTH 0x8452
+#define GL_COLOR_SUM 0x8458
+#define GL_TEXTURE_LOD_BIAS 0x8501
+#define GL_INCR_WRAP 0x8507
+#define GL_DECR_WRAP 0x8508
+typedef void (GLAPIENTRY * PFNGLBLENDCOLORPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const void *pointer);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDDPROC) (GLdouble coord);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDDVPROC) (const GLdouble *coord);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDFPROC) (GLfloat coord);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDFVPROC) (const GLfloat *coord);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei drawcount);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const* indices, GLsizei drawcount);
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERFVPROC) (GLenum pname, const GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERIPROC) (GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERIVPROC) (GLenum pname, const GLint *params);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3BPROC) (GLbyte red, GLbyte green, GLbyte blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3BVPROC) (const GLbyte *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3DPROC) (GLdouble red, GLdouble green, GLdouble blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3DVPROC) (const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3FPROC) (GLfloat red, GLfloat green, GLfloat blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3FVPROC) (const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3IPROC) (GLint red, GLint green, GLint blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3SPROC) (GLshort red, GLshort green, GLshort blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3SVPROC) (const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3UBPROC) (GLubyte red, GLubyte green, GLubyte blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3UBVPROC) (const GLubyte *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3UIPROC) (GLuint red, GLuint green, GLuint blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3USPROC) (GLushort red, GLushort green, GLushort blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3USVPROC) (const GLushort *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2DPROC) (GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2DVPROC) (const GLdouble *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2FPROC) (GLfloat x, GLfloat y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2FVPROC) (const GLfloat *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2IPROC) (GLint x, GLint y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2IVPROC) (const GLint *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2SPROC) (GLshort x, GLshort y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2SVPROC) (const GLshort *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3DPROC) (GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3DVPROC) (const GLdouble *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3FPROC) (GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3FVPROC) (const GLfloat *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3IPROC) (GLint x, GLint y, GLint z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3IVPROC) (const GLint *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3SPROC) (GLshort x, GLshort y, GLshort z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3SVPROC) (const GLshort *p);
+#define glBlendColor GLEW_GET_FUN(__glewBlendColor)
+#define glBlendEquation GLEW_GET_FUN(__glewBlendEquation)
+#define glBlendFuncSeparate GLEW_GET_FUN(__glewBlendFuncSeparate)
+#define glFogCoordPointer GLEW_GET_FUN(__glewFogCoordPointer)
+#define glFogCoordd GLEW_GET_FUN(__glewFogCoordd)
+#define glFogCoorddv GLEW_GET_FUN(__glewFogCoorddv)
+#define glFogCoordf GLEW_GET_FUN(__glewFogCoordf)
+#define glFogCoordfv GLEW_GET_FUN(__glewFogCoordfv)
+#define glMultiDrawArrays GLEW_GET_FUN(__glewMultiDrawArrays)
+#define glMultiDrawElements GLEW_GET_FUN(__glewMultiDrawElements)
+#define glPointParameterf GLEW_GET_FUN(__glewPointParameterf)
+#define glPointParameterfv GLEW_GET_FUN(__glewPointParameterfv)
+#define glPointParameteri GLEW_GET_FUN(__glewPointParameteri)
+#define glPointParameteriv GLEW_GET_FUN(__glewPointParameteriv)
+#define glSecondaryColor3b GLEW_GET_FUN(__glewSecondaryColor3b)
+#define glSecondaryColor3bv GLEW_GET_FUN(__glewSecondaryColor3bv)
+#define glSecondaryColor3d GLEW_GET_FUN(__glewSecondaryColor3d)
+#define glSecondaryColor3dv GLEW_GET_FUN(__glewSecondaryColor3dv)
+#define glSecondaryColor3f GLEW_GET_FUN(__glewSecondaryColor3f)
+#define glSecondaryColor3fv GLEW_GET_FUN(__glewSecondaryColor3fv)
+#define glSecondaryColor3i GLEW_GET_FUN(__glewSecondaryColor3i)
+#define glSecondaryColor3iv GLEW_GET_FUN(__glewSecondaryColor3iv)
+#define glSecondaryColor3s GLEW_GET_FUN(__glewSecondaryColor3s)
+#define glSecondaryColor3sv GLEW_GET_FUN(__glewSecondaryColor3sv)
+#define glSecondaryColor3ub GLEW_GET_FUN(__glewSecondaryColor3ub)
+#define glSecondaryColor3ubv GLEW_GET_FUN(__glewSecondaryColor3ubv)
+#define glSecondaryColor3ui GLEW_GET_FUN(__glewSecondaryColor3ui)
+#define glSecondaryColor3uiv GLEW_GET_FUN(__glewSecondaryColor3uiv)
+#define glSecondaryColor3us GLEW_GET_FUN(__glewSecondaryColor3us)
+#define glSecondaryColor3usv GLEW_GET_FUN(__glewSecondaryColor3usv)
+#define glSecondaryColorPointer GLEW_GET_FUN(__glewSecondaryColorPointer)
+#define glWindowPos2d GLEW_GET_FUN(__glewWindowPos2d)
+#define glWindowPos2dv GLEW_GET_FUN(__glewWindowPos2dv)
+#define glWindowPos2f GLEW_GET_FUN(__glewWindowPos2f)
+#define glWindowPos2fv GLEW_GET_FUN(__glewWindowPos2fv)
+#define glWindowPos2i GLEW_GET_FUN(__glewWindowPos2i)
+#define glWindowPos2iv GLEW_GET_FUN(__glewWindowPos2iv)
+#define glWindowPos2s GLEW_GET_FUN(__glewWindowPos2s)
+#define glWindowPos2sv GLEW_GET_FUN(__glewWindowPos2sv)
+#define glWindowPos3d GLEW_GET_FUN(__glewWindowPos3d)
+#define glWindowPos3dv GLEW_GET_FUN(__glewWindowPos3dv)
+#define glWindowPos3f GLEW_GET_FUN(__glewWindowPos3f)
+#define glWindowPos3fv GLEW_GET_FUN(__glewWindowPos3fv)
+#define glWindowPos3i GLEW_GET_FUN(__glewWindowPos3i)
+#define glWindowPos3iv GLEW_GET_FUN(__glewWindowPos3iv)
+#define glWindowPos3s GLEW_GET_FUN(__glewWindowPos3s)
+#define glWindowPos3sv GLEW_GET_FUN(__glewWindowPos3sv)
+#endif /* GL_VERSION_1_4 */
+/* ----------------------------- GL_VERSION_1_5 ---------------------------- */
+#ifndef GL_VERSION_1_5
+#define GL_VERSION_1_5 1
+#define GL_BUFFER_SIZE 0x8764
+#define GL_BUFFER_USAGE 0x8765
+#define GL_QUERY_COUNTER_BITS 0x8864
+#define GL_CURRENT_QUERY 0x8865
+#define GL_QUERY_RESULT 0x8866
+#define GL_ARRAY_BUFFER 0x8892
+#define GL_READ_ONLY 0x88B8
+#define GL_WRITE_ONLY 0x88B9
+#define GL_READ_WRITE 0x88BA
+#define GL_BUFFER_ACCESS 0x88BB
+#define GL_BUFFER_MAPPED 0x88BC
+#define GL_STREAM_DRAW 0x88E0
+#define GL_STREAM_READ 0x88E1
+#define GL_STREAM_COPY 0x88E2
+#define GL_STATIC_DRAW 0x88E4
+#define GL_STATIC_READ 0x88E5
+#define GL_STATIC_COPY 0x88E6
+#define GL_DYNAMIC_DRAW 0x88E8
+#define GL_DYNAMIC_READ 0x88E9
+#define GL_DYNAMIC_COPY 0x88EA
+#define GL_SAMPLES_PASSED 0x8914
+typedef ptrdiff_t GLintptr;
+typedef ptrdiff_t GLsizeiptr;
+typedef void (GLAPIENTRY * PFNGLBEGINQUERYPROC) (GLenum target, GLuint id);
+typedef void (GLAPIENTRY * PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer);
+typedef void (GLAPIENTRY * PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const void* data, GLenum usage);
+typedef void (GLAPIENTRY * PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const void* data);
+typedef void (GLAPIENTRY * PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint* buffers);
+typedef void (GLAPIENTRY * PFNGLDELETEQUERIESPROC) (GLsizei n, const GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLENDQUERYPROC) (GLenum target);
+typedef void (GLAPIENTRY * PFNGLGENBUFFERSPROC) (GLsizei n, GLuint* buffers);
+typedef void (GLAPIENTRY * PFNGLGENQUERIESPROC) (GLsizei n, GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, void** params);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, void* data);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTIVPROC) (GLuint id, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTUIVPROC) (GLuint id, GLenum pname, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYIVPROC) (GLenum target, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISBUFFERPROC) (GLuint buffer);
+typedef GLboolean (GLAPIENTRY * PFNGLISQUERYPROC) (GLuint id);
+typedef void* (GLAPIENTRY * PFNGLMAPBUFFERPROC) (GLenum target, GLenum access);
+typedef GLboolean (GLAPIENTRY * PFNGLUNMAPBUFFERPROC) (GLenum target);
+#define glBeginQuery GLEW_GET_FUN(__glewBeginQuery)
+#define glBindBuffer GLEW_GET_FUN(__glewBindBuffer)
+#define glBufferData GLEW_GET_FUN(__glewBufferData)
+#define glBufferSubData GLEW_GET_FUN(__glewBufferSubData)
+#define glDeleteBuffers GLEW_GET_FUN(__glewDeleteBuffers)
+#define glDeleteQueries GLEW_GET_FUN(__glewDeleteQueries)
+#define glEndQuery GLEW_GET_FUN(__glewEndQuery)
+#define glGenBuffers GLEW_GET_FUN(__glewGenBuffers)
+#define glGenQueries GLEW_GET_FUN(__glewGenQueries)
+#define glGetBufferParameteriv GLEW_GET_FUN(__glewGetBufferParameteriv)
+#define glGetBufferPointerv GLEW_GET_FUN(__glewGetBufferPointerv)
+#define glGetBufferSubData GLEW_GET_FUN(__glewGetBufferSubData)
+#define glGetQueryObjectiv GLEW_GET_FUN(__glewGetQueryObjectiv)
+#define glGetQueryObjectuiv GLEW_GET_FUN(__glewGetQueryObjectuiv)
+#define glGetQueryiv GLEW_GET_FUN(__glewGetQueryiv)
+#define glIsBuffer GLEW_GET_FUN(__glewIsBuffer)
+#define glIsQuery GLEW_GET_FUN(__glewIsQuery)
+#define glMapBuffer GLEW_GET_FUN(__glewMapBuffer)
+#define glUnmapBuffer GLEW_GET_FUN(__glewUnmapBuffer)
+#endif /* GL_VERSION_1_5 */
+/* ----------------------------- GL_VERSION_2_0 ---------------------------- */
+#ifndef GL_VERSION_2_0
+#define GL_VERSION_2_0 1
+#define GL_STENCIL_BACK_FUNC 0x8800
+#define GL_STENCIL_BACK_FAIL 0x8801
+#define GL_MAX_DRAW_BUFFERS 0x8824
+#define GL_DRAW_BUFFER0 0x8825
+#define GL_DRAW_BUFFER1 0x8826
+#define GL_DRAW_BUFFER2 0x8827
+#define GL_DRAW_BUFFER3 0x8828
+#define GL_DRAW_BUFFER4 0x8829
+#define GL_DRAW_BUFFER5 0x882A
+#define GL_DRAW_BUFFER6 0x882B
+#define GL_DRAW_BUFFER7 0x882C
+#define GL_DRAW_BUFFER8 0x882D
+#define GL_DRAW_BUFFER9 0x882E
+#define GL_DRAW_BUFFER10 0x882F
+#define GL_DRAW_BUFFER11 0x8830
+#define GL_DRAW_BUFFER12 0x8831
+#define GL_DRAW_BUFFER13 0x8832
+#define GL_DRAW_BUFFER14 0x8833
+#define GL_DRAW_BUFFER15 0x8834
+#define GL_POINT_SPRITE 0x8861
+#define GL_COORD_REPLACE 0x8862
+#define GL_MAX_VERTEX_ATTRIBS 0x8869
+#define GL_MAX_TEXTURE_COORDS 0x8871
+#define GL_FRAGMENT_SHADER 0x8B30
+#define GL_VERTEX_SHADER 0x8B31
+#define GL_SHADER_TYPE 0x8B4F
+#define GL_FLOAT_VEC2 0x8B50
+#define GL_FLOAT_VEC3 0x8B51
+#define GL_FLOAT_VEC4 0x8B52
+#define GL_INT_VEC2 0x8B53
+#define GL_INT_VEC3 0x8B54
+#define GL_INT_VEC4 0x8B55
+#define GL_BOOL 0x8B56
+#define GL_BOOL_VEC2 0x8B57
+#define GL_BOOL_VEC3 0x8B58
+#define GL_BOOL_VEC4 0x8B59
+#define GL_FLOAT_MAT2 0x8B5A
+#define GL_FLOAT_MAT3 0x8B5B
+#define GL_FLOAT_MAT4 0x8B5C
+#define GL_SAMPLER_1D 0x8B5D
+#define GL_SAMPLER_2D 0x8B5E
+#define GL_SAMPLER_3D 0x8B5F
+#define GL_SAMPLER_CUBE 0x8B60
+#define GL_SAMPLER_1D_SHADOW 0x8B61
+#define GL_SAMPLER_2D_SHADOW 0x8B62
+#define GL_DELETE_STATUS 0x8B80
+#define GL_COMPILE_STATUS 0x8B81
+#define GL_LINK_STATUS 0x8B82
+#define GL_VALIDATE_STATUS 0x8B83
+#define GL_INFO_LOG_LENGTH 0x8B84
+#define GL_ACTIVE_UNIFORMS 0x8B86
+#define GL_LOWER_LEFT 0x8CA1
+#define GL_UPPER_LEFT 0x8CA2
+typedef void (GLAPIENTRY * PFNGLATTACHSHADERPROC) (GLuint program, GLuint shader);
+typedef void (GLAPIENTRY * PFNGLBINDATTRIBLOCATIONPROC) (GLuint program, GLuint index, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLCOMPILESHADERPROC) (GLuint shader);
+typedef void (GLAPIENTRY * PFNGLDELETEPROGRAMPROC) (GLuint program);
+typedef void (GLAPIENTRY * PFNGLDELETESHADERPROC) (GLuint shader);
+typedef void (GLAPIENTRY * PFNGLDETACHSHADERPROC) (GLuint program, GLuint shader);
+typedef void (GLAPIENTRY * PFNGLDRAWBUFFERSPROC) (GLsizei n, const GLenum* bufs);
+typedef void (GLAPIENTRY * PFNGLGETACTIVEATTRIBPROC) (GLuint program, GLuint index, GLsizei maxLength, GLsizei* length, GLint* size, GLenum* type, GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETACTIVEUNIFORMPROC) (GLuint program, GLuint index, GLsizei maxLength, GLsizei* length, GLint* size, GLenum* type, GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETATTACHEDSHADERSPROC) (GLuint program, GLsizei maxCount, GLsizei* count, GLuint* shaders);
+typedef GLint (GLAPIENTRY * PFNGLGETATTRIBLOCATIONPROC) (GLuint program, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMINFOLOGPROC) (GLuint program, GLsizei bufSize, GLsizei* length, GLchar* infoLog);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMIVPROC) (GLuint program, GLenum pname, GLint* param);
+typedef void (GLAPIENTRY * PFNGLGETSHADERINFOLOGPROC) (GLuint shader, GLsizei bufSize, GLsizei* length, GLchar* infoLog);
+typedef void (GLAPIENTRY * PFNGLGETSHADERSOURCEPROC) (GLuint obj, GLsizei maxLength, GLsizei* length, GLchar* source);
+typedef void (GLAPIENTRY * PFNGLGETSHADERIVPROC) (GLuint shader, GLenum pname, GLint* param);
+typedef GLint (GLAPIENTRY * PFNGLGETUNIFORMLOCATIONPROC) (GLuint program, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMFVPROC) (GLuint program, GLint location, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, void** pointer);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBDVPROC) (GLuint index, GLenum pname, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBFVPROC) (GLuint index, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBIVPROC) (GLuint index, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISPROGRAMPROC) (GLuint program);
+typedef GLboolean (GLAPIENTRY * PFNGLISSHADERPROC) (GLuint shader);
+typedef void (GLAPIENTRY * PFNGLLINKPROGRAMPROC) (GLuint program);
+typedef void (GLAPIENTRY * PFNGLSHADERSOURCEPROC) (GLuint shader, GLsizei count, const GLchar *const* string, const GLint* length);
+typedef void (GLAPIENTRY * PFNGLSTENCILFUNCSEPARATEPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask);
+typedef void (GLAPIENTRY * PFNGLSTENCILMASKSEPARATEPROC) (GLenum face, GLuint mask);
+typedef void (GLAPIENTRY * PFNGLSTENCILOPSEPARATEPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1FPROC) (GLint location, GLfloat v0);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1FVPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1IPROC) (GLint location, GLint v0);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1IVPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2FPROC) (GLint location, GLfloat v0, GLfloat v1);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2FVPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2IPROC) (GLint location, GLint v0, GLint v1);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2IVPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3FVPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3IPROC) (GLint location, GLint v0, GLint v1, GLint v2);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3IVPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4FVPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4IPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4IVPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUSEPROGRAMPROC) (GLuint program);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1DPROC) (GLuint index, GLdouble x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1DVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1FPROC) (GLuint index, GLfloat x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1FVPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1SPROC) (GLuint index, GLshort x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1SVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2DPROC) (GLuint index, GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2DVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2FPROC) (GLuint index, GLfloat x, GLfloat y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2FVPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2SPROC) (GLuint index, GLshort x, GLshort y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2SVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3DVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3FVPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3SPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3SVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NBVPROC) (GLuint index, const GLbyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NIVPROC) (GLuint index, const GLint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NSVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUBVPROC) (GLuint index, const GLubyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUIVPROC) (GLuint index, const GLuint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUSVPROC) (GLuint index, const GLushort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4BVPROC) (GLuint index, const GLbyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4DVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4FVPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4IVPROC) (GLuint index, const GLint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4SPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4SVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4UBVPROC) (GLuint index, const GLubyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4UIVPROC) (GLuint index, const GLuint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4USVPROC) (GLuint index, const GLushort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void* pointer);
+#define glAttachShader GLEW_GET_FUN(__glewAttachShader)
+#define glBindAttribLocation GLEW_GET_FUN(__glewBindAttribLocation)
+#define glBlendEquationSeparate GLEW_GET_FUN(__glewBlendEquationSeparate)
+#define glCompileShader GLEW_GET_FUN(__glewCompileShader)
+#define glCreateProgram GLEW_GET_FUN(__glewCreateProgram)
+#define glCreateShader GLEW_GET_FUN(__glewCreateShader)
+#define glDeleteProgram GLEW_GET_FUN(__glewDeleteProgram)
+#define glDeleteShader GLEW_GET_FUN(__glewDeleteShader)
+#define glDetachShader GLEW_GET_FUN(__glewDetachShader)
+#define glDisableVertexAttribArray GLEW_GET_FUN(__glewDisableVertexAttribArray)
+#define glDrawBuffers GLEW_GET_FUN(__glewDrawBuffers)
+#define glEnableVertexAttribArray GLEW_GET_FUN(__glewEnableVertexAttribArray)
+#define glGetActiveAttrib GLEW_GET_FUN(__glewGetActiveAttrib)
+#define glGetActiveUniform GLEW_GET_FUN(__glewGetActiveUniform)
+#define glGetAttachedShaders GLEW_GET_FUN(__glewGetAttachedShaders)
+#define glGetAttribLocation GLEW_GET_FUN(__glewGetAttribLocation)
+#define glGetProgramInfoLog GLEW_GET_FUN(__glewGetProgramInfoLog)
+#define glGetProgramiv GLEW_GET_FUN(__glewGetProgramiv)
+#define glGetShaderInfoLog GLEW_GET_FUN(__glewGetShaderInfoLog)
+#define glGetShaderSource GLEW_GET_FUN(__glewGetShaderSource)
+#define glGetShaderiv GLEW_GET_FUN(__glewGetShaderiv)
+#define glGetUniformLocation GLEW_GET_FUN(__glewGetUniformLocation)
+#define glGetUniformfv GLEW_GET_FUN(__glewGetUniformfv)
+#define glGetUniformiv GLEW_GET_FUN(__glewGetUniformiv)
+#define glGetVertexAttribPointerv GLEW_GET_FUN(__glewGetVertexAttribPointerv)
+#define glGetVertexAttribdv GLEW_GET_FUN(__glewGetVertexAttribdv)
+#define glGetVertexAttribfv GLEW_GET_FUN(__glewGetVertexAttribfv)
+#define glGetVertexAttribiv GLEW_GET_FUN(__glewGetVertexAttribiv)
+#define glIsProgram GLEW_GET_FUN(__glewIsProgram)
+#define glIsShader GLEW_GET_FUN(__glewIsShader)
+#define glLinkProgram GLEW_GET_FUN(__glewLinkProgram)
+#define glShaderSource GLEW_GET_FUN(__glewShaderSource)
+#define glStencilFuncSeparate GLEW_GET_FUN(__glewStencilFuncSeparate)
+#define glStencilMaskSeparate GLEW_GET_FUN(__glewStencilMaskSeparate)
+#define glStencilOpSeparate GLEW_GET_FUN(__glewStencilOpSeparate)
+#define glUniform1f GLEW_GET_FUN(__glewUniform1f)
+#define glUniform1fv GLEW_GET_FUN(__glewUniform1fv)
+#define glUniform1i GLEW_GET_FUN(__glewUniform1i)
+#define glUniform1iv GLEW_GET_FUN(__glewUniform1iv)
+#define glUniform2f GLEW_GET_FUN(__glewUniform2f)
+#define glUniform2fv GLEW_GET_FUN(__glewUniform2fv)
+#define glUniform2i GLEW_GET_FUN(__glewUniform2i)
+#define glUniform2iv GLEW_GET_FUN(__glewUniform2iv)
+#define glUniform3f GLEW_GET_FUN(__glewUniform3f)
+#define glUniform3fv GLEW_GET_FUN(__glewUniform3fv)
+#define glUniform3i GLEW_GET_FUN(__glewUniform3i)
+#define glUniform3iv GLEW_GET_FUN(__glewUniform3iv)
+#define glUniform4f GLEW_GET_FUN(__glewUniform4f)
+#define glUniform4fv GLEW_GET_FUN(__glewUniform4fv)
+#define glUniform4i GLEW_GET_FUN(__glewUniform4i)
+#define glUniform4iv GLEW_GET_FUN(__glewUniform4iv)
+#define glUniformMatrix2fv GLEW_GET_FUN(__glewUniformMatrix2fv)
+#define glUniformMatrix3fv GLEW_GET_FUN(__glewUniformMatrix3fv)
+#define glUniformMatrix4fv GLEW_GET_FUN(__glewUniformMatrix4fv)
+#define glUseProgram GLEW_GET_FUN(__glewUseProgram)
+#define glValidateProgram GLEW_GET_FUN(__glewValidateProgram)
+#define glVertexAttrib1d GLEW_GET_FUN(__glewVertexAttrib1d)
+#define glVertexAttrib1dv GLEW_GET_FUN(__glewVertexAttrib1dv)
+#define glVertexAttrib1f GLEW_GET_FUN(__glewVertexAttrib1f)
+#define glVertexAttrib1fv GLEW_GET_FUN(__glewVertexAttrib1fv)
+#define glVertexAttrib1s GLEW_GET_FUN(__glewVertexAttrib1s)
+#define glVertexAttrib1sv GLEW_GET_FUN(__glewVertexAttrib1sv)
+#define glVertexAttrib2d GLEW_GET_FUN(__glewVertexAttrib2d)
+#define glVertexAttrib2dv GLEW_GET_FUN(__glewVertexAttrib2dv)
+#define glVertexAttrib2f GLEW_GET_FUN(__glewVertexAttrib2f)
+#define glVertexAttrib2fv GLEW_GET_FUN(__glewVertexAttrib2fv)
+#define glVertexAttrib2s GLEW_GET_FUN(__glewVertexAttrib2s)
+#define glVertexAttrib2sv GLEW_GET_FUN(__glewVertexAttrib2sv)
+#define glVertexAttrib3d GLEW_GET_FUN(__glewVertexAttrib3d)
+#define glVertexAttrib3dv GLEW_GET_FUN(__glewVertexAttrib3dv)
+#define glVertexAttrib3f GLEW_GET_FUN(__glewVertexAttrib3f)
+#define glVertexAttrib3fv GLEW_GET_FUN(__glewVertexAttrib3fv)
+#define glVertexAttrib3s GLEW_GET_FUN(__glewVertexAttrib3s)
+#define glVertexAttrib3sv GLEW_GET_FUN(__glewVertexAttrib3sv)
+#define glVertexAttrib4Nbv GLEW_GET_FUN(__glewVertexAttrib4Nbv)
+#define glVertexAttrib4Niv GLEW_GET_FUN(__glewVertexAttrib4Niv)
+#define glVertexAttrib4Nsv GLEW_GET_FUN(__glewVertexAttrib4Nsv)
+#define glVertexAttrib4Nub GLEW_GET_FUN(__glewVertexAttrib4Nub)
+#define glVertexAttrib4Nubv GLEW_GET_FUN(__glewVertexAttrib4Nubv)
+#define glVertexAttrib4Nuiv GLEW_GET_FUN(__glewVertexAttrib4Nuiv)
+#define glVertexAttrib4Nusv GLEW_GET_FUN(__glewVertexAttrib4Nusv)
+#define glVertexAttrib4bv GLEW_GET_FUN(__glewVertexAttrib4bv)
+#define glVertexAttrib4d GLEW_GET_FUN(__glewVertexAttrib4d)
+#define glVertexAttrib4dv GLEW_GET_FUN(__glewVertexAttrib4dv)
+#define glVertexAttrib4f GLEW_GET_FUN(__glewVertexAttrib4f)
+#define glVertexAttrib4fv GLEW_GET_FUN(__glewVertexAttrib4fv)
+#define glVertexAttrib4iv GLEW_GET_FUN(__glewVertexAttrib4iv)
+#define glVertexAttrib4s GLEW_GET_FUN(__glewVertexAttrib4s)
+#define glVertexAttrib4sv GLEW_GET_FUN(__glewVertexAttrib4sv)
+#define glVertexAttrib4ubv GLEW_GET_FUN(__glewVertexAttrib4ubv)
+#define glVertexAttrib4uiv GLEW_GET_FUN(__glewVertexAttrib4uiv)
+#define glVertexAttrib4usv GLEW_GET_FUN(__glewVertexAttrib4usv)
+#define glVertexAttribPointer GLEW_GET_FUN(__glewVertexAttribPointer)
+#endif /* GL_VERSION_2_0 */
+/* ----------------------------- GL_VERSION_2_1 ---------------------------- */
+#ifndef GL_VERSION_2_1
+#define GL_VERSION_2_1 1
+#define GL_FLOAT_MAT2x3 0x8B65
+#define GL_FLOAT_MAT2x4 0x8B66
+#define GL_FLOAT_MAT3x2 0x8B67
+#define GL_FLOAT_MAT3x4 0x8B68
+#define GL_FLOAT_MAT4x2 0x8B69
+#define GL_FLOAT_MAT4x3 0x8B6A
+#define GL_SRGB 0x8C40
+#define GL_SRGB8 0x8C41
+#define GL_SRGB_ALPHA 0x8C42
+#define GL_SRGB8_ALPHA8 0x8C43
+#define GL_SLUMINANCE8_ALPHA8 0x8C45
+#define GL_SLUMINANCE 0x8C46
+#define GL_SLUMINANCE8 0x8C47
+#define GL_COMPRESSED_SRGB 0x8C48
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2X3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2X4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3X2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3X4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4X2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4X3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+#define glUniformMatrix2x3fv GLEW_GET_FUN(__glewUniformMatrix2x3fv)
+#define glUniformMatrix2x4fv GLEW_GET_FUN(__glewUniformMatrix2x4fv)
+#define glUniformMatrix3x2fv GLEW_GET_FUN(__glewUniformMatrix3x2fv)
+#define glUniformMatrix3x4fv GLEW_GET_FUN(__glewUniformMatrix3x4fv)
+#define glUniformMatrix4x2fv GLEW_GET_FUN(__glewUniformMatrix4x2fv)
+#define glUniformMatrix4x3fv GLEW_GET_FUN(__glewUniformMatrix4x3fv)
+#endif /* GL_VERSION_2_1 */
+/* ----------------------------- GL_VERSION_3_0 ---------------------------- */
+#ifndef GL_VERSION_3_0
+#define GL_VERSION_3_0 1
+#define GL_MAJOR_VERSION 0x821B
+#define GL_MINOR_VERSION 0x821C
+#define GL_NUM_EXTENSIONS 0x821D
+#define GL_CONTEXT_FLAGS 0x821E
+#define GL_DEPTH_BUFFER 0x8223
+#define GL_STENCIL_BUFFER 0x8224
+#define GL_RGBA32F 0x8814
+#define GL_RGB32F 0x8815
+#define GL_RGBA16F 0x881A
+#define GL_RGB16F 0x881B
+#define GL_CLAMP_READ_COLOR 0x891C
+#define GL_FIXED_ONLY 0x891D
+#define GL_TEXTURE_RED_TYPE 0x8C10
+#define GL_TEXTURE_BLUE_TYPE 0x8C12
+#define GL_TEXTURE_1D_ARRAY 0x8C18
+#define GL_TEXTURE_2D_ARRAY 0x8C1A
+#define GL_R11F_G11F_B10F 0x8C3A
+#define GL_UNSIGNED_INT_10F_11F_11F_REV 0x8C3B
+#define GL_RGB9_E5 0x8C3D
+#define GL_UNSIGNED_INT_5_9_9_9_REV 0x8C3E
+#define GL_RGBA32UI 0x8D70
+#define GL_RGB32UI 0x8D71
+#define GL_RGBA16UI 0x8D76
+#define GL_RGB16UI 0x8D77
+#define GL_RGBA8UI 0x8D7C
+#define GL_RGB8UI 0x8D7D
+#define GL_RGBA32I 0x8D82
+#define GL_RGB32I 0x8D83
+#define GL_RGBA16I 0x8D88
+#define GL_RGB16I 0x8D89
+#define GL_RGBA8I 0x8D8E
+#define GL_RGB8I 0x8D8F
+#define GL_RED_INTEGER 0x8D94
+#define GL_GREEN_INTEGER 0x8D95
+#define GL_BLUE_INTEGER 0x8D96
+#define GL_ALPHA_INTEGER 0x8D97
+#define GL_RGB_INTEGER 0x8D98
+#define GL_RGBA_INTEGER 0x8D99
+#define GL_BGR_INTEGER 0x8D9A
+#define GL_BGRA_INTEGER 0x8D9B
+#define GL_SAMPLER_1D_ARRAY 0x8DC0
+#define GL_SAMPLER_2D_ARRAY 0x8DC1
+#define GL_UNSIGNED_INT_VEC2 0x8DC6
+#define GL_UNSIGNED_INT_VEC3 0x8DC7
+#define GL_UNSIGNED_INT_VEC4 0x8DC8
+#define GL_INT_SAMPLER_1D 0x8DC9
+#define GL_INT_SAMPLER_2D 0x8DCA
+#define GL_INT_SAMPLER_3D 0x8DCB
+#define GL_QUERY_WAIT 0x8E13
+#define GL_QUERY_NO_WAIT 0x8E14
+typedef void (GLAPIENTRY * PFNGLBINDFRAGDATALOCATIONPROC) (GLuint program, GLuint colorNumber, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLCLAMPCOLORPROC) (GLenum target, GLenum clamp);
+typedef void (GLAPIENTRY * PFNGLCLEARBUFFERFIPROC) (GLenum buffer, GLint drawBuffer, GLfloat depth, GLint stencil);
+typedef void (GLAPIENTRY * PFNGLCLEARBUFFERFVPROC) (GLenum buffer, GLint drawBuffer, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLCLEARBUFFERIVPROC) (GLenum buffer, GLint drawBuffer, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLCLEARBUFFERUIVPROC) (GLenum buffer, GLint drawBuffer, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLCOLORMASKIPROC) (GLuint buf, GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha);
+typedef void (GLAPIENTRY * PFNGLDISABLEIPROC) (GLenum cap, GLuint index);
+typedef void (GLAPIENTRY * PFNGLENABLEIPROC) (GLenum cap, GLuint index);
+typedef void (GLAPIENTRY * PFNGLGETBOOLEANI_VPROC) (GLenum pname, GLuint index, GLboolean* data);
+typedef GLint (GLAPIENTRY * PFNGLGETFRAGDATALOCATIONPROC) (GLuint program, const GLchar* name);
+typedef const GLubyte* (GLAPIENTRY * PFNGLGETSTRINGIPROC) (GLenum name, GLuint index);
+typedef void (GLAPIENTRY * PFNGLGETTEXPARAMETERIIVPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXPARAMETERIUIVPROC) (GLenum target, GLenum pname, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETTRANSFORMFEEDBACKVARYINGPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei * length, GLsizei * size, GLenum * type, GLchar * name);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMUIVPROC) (GLuint program, GLint location, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBIIVPROC) (GLuint index, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBIUIVPROC) (GLuint index, GLenum pname, GLuint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISENABLEDIPROC) (GLenum cap, GLuint index);
+typedef void (GLAPIENTRY * PFNGLTEXPARAMETERIIVPROC) (GLenum target, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLTEXPARAMETERIUIVPROC) (GLenum target, GLenum pname, const GLuint* params);
+typedef void (GLAPIENTRY * PFNGLTRANSFORMFEEDBACKVARYINGSPROC) (GLuint program, GLsizei count, const GLchar *const* varyings, GLenum bufferMode);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1UIPROC) (GLint location, GLuint v0);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1UIVPROC) (GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2UIPROC) (GLint location, GLuint v0, GLuint v1);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2UIVPROC) (GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3UIPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3UIVPROC) (GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4UIPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4UIVPROC) (GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI1IPROC) (GLuint index, GLint v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI1IVPROC) (GLuint index, const GLint* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI1UIPROC) (GLuint index, GLuint v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI1UIVPROC) (GLuint index, const GLuint* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI2IPROC) (GLuint index, GLint v0, GLint v1);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI2IVPROC) (GLuint index, const GLint* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI2UIPROC) (GLuint index, GLuint v0, GLuint v1);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI2UIVPROC) (GLuint index, const GLuint* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI3IPROC) (GLuint index, GLint v0, GLint v1, GLint v2);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI3IVPROC) (GLuint index, const GLint* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI3UIPROC) (GLuint index, GLuint v0, GLuint v1, GLuint v2);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI3UIVPROC) (GLuint index, const GLuint* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI4BVPROC) (GLuint index, const GLbyte* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI4IPROC) (GLuint index, GLint v0, GLint v1, GLint v2, GLint v3);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI4IVPROC) (GLuint index, const GLint* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI4SVPROC) (GLuint index, const GLshort* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI4UBVPROC) (GLuint index, const GLubyte* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI4UIPROC) (GLuint index, GLuint v0, GLuint v1, GLuint v2, GLuint v3);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI4UIVPROC) (GLuint index, const GLuint* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBI4USVPROC) (GLuint index, const GLushort* v0);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBIPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void*pointer);
+#define glBeginConditionalRender GLEW_GET_FUN(__glewBeginConditionalRender)
+#define glBeginTransformFeedback GLEW_GET_FUN(__glewBeginTransformFeedback)
+#define glBindFragDataLocation GLEW_GET_FUN(__glewBindFragDataLocation)
+#define glClampColor GLEW_GET_FUN(__glewClampColor)
+#define glClearBufferfi GLEW_GET_FUN(__glewClearBufferfi)
+#define glClearBufferfv GLEW_GET_FUN(__glewClearBufferfv)
+#define glClearBufferiv GLEW_GET_FUN(__glewClearBufferiv)
+#define glClearBufferuiv GLEW_GET_FUN(__glewClearBufferuiv)
+#define glColorMaski GLEW_GET_FUN(__glewColorMaski)
+#define glDisablei GLEW_GET_FUN(__glewDisablei)
+#define glEnablei GLEW_GET_FUN(__glewEnablei)
+#define glEndConditionalRender GLEW_GET_FUN(__glewEndConditionalRender)
+#define glEndTransformFeedback GLEW_GET_FUN(__glewEndTransformFeedback)
+#define glGetBooleani_v GLEW_GET_FUN(__glewGetBooleani_v)
+#define glGetFragDataLocation GLEW_GET_FUN(__glewGetFragDataLocation)
+#define glGetStringi GLEW_GET_FUN(__glewGetStringi)
+#define glGetTexParameterIiv GLEW_GET_FUN(__glewGetTexParameterIiv)
+#define glGetTexParameterIuiv GLEW_GET_FUN(__glewGetTexParameterIuiv)
+#define glGetTransformFeedbackVarying GLEW_GET_FUN(__glewGetTransformFeedbackVarying)
+#define glGetUniformuiv GLEW_GET_FUN(__glewGetUniformuiv)
+#define glGetVertexAttribIiv GLEW_GET_FUN(__glewGetVertexAttribIiv)
+#define glGetVertexAttribIuiv GLEW_GET_FUN(__glewGetVertexAttribIuiv)
+#define glIsEnabledi GLEW_GET_FUN(__glewIsEnabledi)
+#define glTexParameterIiv GLEW_GET_FUN(__glewTexParameterIiv)
+#define glTexParameterIuiv GLEW_GET_FUN(__glewTexParameterIuiv)
+#define glTransformFeedbackVaryings GLEW_GET_FUN(__glewTransformFeedbackVaryings)
+#define glUniform1ui GLEW_GET_FUN(__glewUniform1ui)
+#define glUniform1uiv GLEW_GET_FUN(__glewUniform1uiv)
+#define glUniform2ui GLEW_GET_FUN(__glewUniform2ui)
+#define glUniform2uiv GLEW_GET_FUN(__glewUniform2uiv)
+#define glUniform3ui GLEW_GET_FUN(__glewUniform3ui)
+#define glUniform3uiv GLEW_GET_FUN(__glewUniform3uiv)
+#define glUniform4ui GLEW_GET_FUN(__glewUniform4ui)
+#define glUniform4uiv GLEW_GET_FUN(__glewUniform4uiv)
+#define glVertexAttribI1i GLEW_GET_FUN(__glewVertexAttribI1i)
+#define glVertexAttribI1iv GLEW_GET_FUN(__glewVertexAttribI1iv)
+#define glVertexAttribI1ui GLEW_GET_FUN(__glewVertexAttribI1ui)
+#define glVertexAttribI1uiv GLEW_GET_FUN(__glewVertexAttribI1uiv)
+#define glVertexAttribI2i GLEW_GET_FUN(__glewVertexAttribI2i)
+#define glVertexAttribI2iv GLEW_GET_FUN(__glewVertexAttribI2iv)
+#define glVertexAttribI2ui GLEW_GET_FUN(__glewVertexAttribI2ui)
+#define glVertexAttribI2uiv GLEW_GET_FUN(__glewVertexAttribI2uiv)
+#define glVertexAttribI3i GLEW_GET_FUN(__glewVertexAttribI3i)
+#define glVertexAttribI3iv GLEW_GET_FUN(__glewVertexAttribI3iv)
+#define glVertexAttribI3ui GLEW_GET_FUN(__glewVertexAttribI3ui)
+#define glVertexAttribI3uiv GLEW_GET_FUN(__glewVertexAttribI3uiv)
+#define glVertexAttribI4bv GLEW_GET_FUN(__glewVertexAttribI4bv)
+#define glVertexAttribI4i GLEW_GET_FUN(__glewVertexAttribI4i)
+#define glVertexAttribI4iv GLEW_GET_FUN(__glewVertexAttribI4iv)
+#define glVertexAttribI4sv GLEW_GET_FUN(__glewVertexAttribI4sv)
+#define glVertexAttribI4ubv GLEW_GET_FUN(__glewVertexAttribI4ubv)
+#define glVertexAttribI4ui GLEW_GET_FUN(__glewVertexAttribI4ui)
+#define glVertexAttribI4uiv GLEW_GET_FUN(__glewVertexAttribI4uiv)
+#define glVertexAttribI4usv GLEW_GET_FUN(__glewVertexAttribI4usv)
+#define glVertexAttribIPointer GLEW_GET_FUN(__glewVertexAttribIPointer)
+#endif /* GL_VERSION_3_0 */
+/* ----------------------------- GL_VERSION_3_1 ---------------------------- */
+#ifndef GL_VERSION_3_1
+#define GL_VERSION_3_1 1
+#define GL_SAMPLER_2D_RECT 0x8B63
+#define GL_RED_SNORM 0x8F90
+#define GL_RG_SNORM 0x8F91
+#define GL_RGB_SNORM 0x8F92
+#define GL_RGBA_SNORM 0x8F93
+#define GL_R8_SNORM 0x8F94
+#define GL_RG8_SNORM 0x8F95
+#define GL_RGB8_SNORM 0x8F96
+#define GL_RGBA8_SNORM 0x8F97
+#define GL_R16_SNORM 0x8F98
+#define GL_RG16_SNORM 0x8F99
+#define GL_RGB16_SNORM 0x8F9A
+#define GL_RGBA16_SNORM 0x8F9B
+#define GL_BUFFER_MAP_LENGTH 0x9120
+#define GL_BUFFER_MAP_OFFSET 0x9121
+typedef void (GLAPIENTRY * PFNGLDRAWARRAYSINSTANCEDPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDPROC) (GLenum mode, GLsizei count, GLenum type, const void* indices, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLTEXBUFFERPROC) (GLenum target, GLenum internalFormat, GLuint buffer);
+#define glDrawArraysInstanced GLEW_GET_FUN(__glewDrawArraysInstanced)
+#define glDrawElementsInstanced GLEW_GET_FUN(__glewDrawElementsInstanced)
+#define glPrimitiveRestartIndex GLEW_GET_FUN(__glewPrimitiveRestartIndex)
+#define glTexBuffer GLEW_GET_FUN(__glewTexBuffer)
+#endif /* GL_VERSION_3_1 */
+/* ----------------------------- GL_VERSION_3_2 ---------------------------- */
+#ifndef GL_VERSION_3_2
+#define GL_VERSION_3_2 1
+#define GL_CONTEXT_CORE_PROFILE_BIT 0x00000001
+#define GL_LINES_ADJACENCY 0x000A
+#define GL_PROGRAM_POINT_SIZE 0x8642
+#define GL_GEOMETRY_INPUT_TYPE 0x8917
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTUREPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERPARAMETERI64VPROC) (GLenum target, GLenum value, GLint64 * data);
+typedef void (GLAPIENTRY * PFNGLGETINTEGER64I_VPROC) (GLenum pname, GLuint index, GLint64 * data);
+#define glFramebufferTexture GLEW_GET_FUN(__glewFramebufferTexture)
+#define glGetBufferParameteri64v GLEW_GET_FUN(__glewGetBufferParameteri64v)
+#define glGetInteger64i_v GLEW_GET_FUN(__glewGetInteger64i_v)
+#endif /* GL_VERSION_3_2 */
+/* ----------------------------- GL_VERSION_3_3 ---------------------------- */
+#ifndef GL_VERSION_3_3
+#define GL_VERSION_3_3 1
+#define GL_RGB10_A2UI 0x906F
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBDIVISORPROC) (GLuint index, GLuint divisor);
+#define glVertexAttribDivisor GLEW_GET_FUN(__glewVertexAttribDivisor)
+#endif /* GL_VERSION_3_3 */
+/* ----------------------------- GL_VERSION_4_0 ---------------------------- */
+#ifndef GL_VERSION_4_0
+#define GL_VERSION_4_0 1
+#define GL_SAMPLE_SHADING 0x8C36
+typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONSEPARATEIPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha);
+typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONIPROC) (GLuint buf, GLenum mode);
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCSEPARATEIPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha);
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCIPROC) (GLuint buf, GLenum src, GLenum dst);
+#define glBlendEquationSeparatei GLEW_GET_FUN(__glewBlendEquationSeparatei)
+#define glBlendEquationi GLEW_GET_FUN(__glewBlendEquationi)
+#define glBlendFuncSeparatei GLEW_GET_FUN(__glewBlendFuncSeparatei)
+#define glBlendFunci GLEW_GET_FUN(__glewBlendFunci)
+#define glMinSampleShading GLEW_GET_FUN(__glewMinSampleShading)
+#endif /* GL_VERSION_4_0 */
+/* ----------------------------- GL_VERSION_4_1 ---------------------------- */
+#ifndef GL_VERSION_4_1
+#define GL_VERSION_4_1 1
+#endif /* GL_VERSION_4_1 */
+/* ----------------------------- GL_VERSION_4_2 ---------------------------- */
+#ifndef GL_VERSION_4_2
+#define GL_VERSION_4_2 1
+#endif /* GL_VERSION_4_2 */
+/* ----------------------------- GL_VERSION_4_3 ---------------------------- */
+#ifndef GL_VERSION_4_3
+#define GL_VERSION_4_3 1
+#endif /* GL_VERSION_4_3 */
+/* ----------------------------- GL_VERSION_4_4 ---------------------------- */
+#ifndef GL_VERSION_4_4
+#define GL_VERSION_4_4 1
+#endif /* GL_VERSION_4_4 */
+/* ----------------------------- GL_VERSION_4_5 ---------------------------- */
+#ifndef GL_VERSION_4_5
+#define GL_VERSION_4_5 1
+typedef void (GLAPIENTRY * PFNGLGETNCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint lod, GLsizei bufSize, GLvoid *pixels);
+typedef void (GLAPIENTRY * PFNGLGETNTEXIMAGEPROC) (GLenum tex, GLint level, GLenum format, GLenum type, GLsizei bufSize, GLvoid *pixels);
+typedef void (GLAPIENTRY * PFNGLGETNUNIFORMDVPROC) (GLuint program, GLint location, GLsizei bufSize, GLdouble *params);
+#define glGetGraphicsResetStatus GLEW_GET_FUN(__glewGetGraphicsResetStatus)
+#define glGetnCompressedTexImage GLEW_GET_FUN(__glewGetnCompressedTexImage)
+#define glGetnTexImage GLEW_GET_FUN(__glewGetnTexImage)
+#define glGetnUniformdv GLEW_GET_FUN(__glewGetnUniformdv)
+#endif /* GL_VERSION_4_5 */
+/* ----------------------------- GL_VERSION_4_6 ---------------------------- */
+#ifndef GL_VERSION_4_6
+#define GL_VERSION_4_6 1
+#define GL_CONTEXT_FLAG_NO_ERROR_BIT 0x00000008
+#define GL_SPIR_V_BINARY 0x9552
+#define GL_SPIR_V_EXTENSIONS 0x9553
+#define GL_NUM_SPIR_V_EXTENSIONS 0x9554
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWARRAYSINDIRECTCOUNTPROC) (GLenum mode, const GLvoid *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTPROC) (GLenum mode, GLenum type, const GLvoid *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride);
+typedef void (GLAPIENTRY * PFNGLSPECIALIZESHADERPROC) (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue);
+#define glMultiDrawArraysIndirectCount GLEW_GET_FUN(__glewMultiDrawArraysIndirectCount)
+#define glMultiDrawElementsIndirectCount GLEW_GET_FUN(__glewMultiDrawElementsIndirectCount)
+#define glSpecializeShader GLEW_GET_FUN(__glewSpecializeShader)
+#endif /* GL_VERSION_4_6 */
+/* -------------------------- GL_3DFX_multisample -------------------------- */
+#ifndef GL_3DFX_multisample
+#define GL_3DFX_multisample 1
+#define GL_MULTISAMPLE_3DFX 0x86B2
+#define GL_SAMPLE_BUFFERS_3DFX 0x86B3
+#define GL_SAMPLES_3DFX 0x86B4
+#define GL_MULTISAMPLE_BIT_3DFX 0x20000000
+#define GLEW_3DFX_multisample GLEW_GET_VAR(__GLEW_3DFX_multisample)
+#endif /* GL_3DFX_multisample */
+/* ---------------------------- GL_3DFX_tbuffer ---------------------------- */
+#ifndef GL_3DFX_tbuffer
+#define GL_3DFX_tbuffer 1
+#define glTbufferMask3DFX GLEW_GET_FUN(__glewTbufferMask3DFX)
+#define GLEW_3DFX_tbuffer GLEW_GET_VAR(__GLEW_3DFX_tbuffer)
+#endif /* GL_3DFX_tbuffer */
+/* -------------------- GL_3DFX_texture_compression_FXT1 ------------------- */
+#ifndef GL_3DFX_texture_compression_FXT1
+#define GL_3DFX_texture_compression_FXT1 1
+#define GLEW_3DFX_texture_compression_FXT1 GLEW_GET_VAR(__GLEW_3DFX_texture_compression_FXT1)
+#endif /* GL_3DFX_texture_compression_FXT1 */
+/* ----------------------- GL_AMD_blend_minmax_factor ---------------------- */
+#ifndef GL_AMD_blend_minmax_factor
+#define GL_AMD_blend_minmax_factor 1
+#define GL_FACTOR_MIN_AMD 0x901C
+#define GL_FACTOR_MAX_AMD 0x901D
+#define GLEW_AMD_blend_minmax_factor GLEW_GET_VAR(__GLEW_AMD_blend_minmax_factor)
+#endif /* GL_AMD_blend_minmax_factor */
+/* --------------------- GL_AMD_compressed_3DC_texture --------------------- */
+#ifndef GL_AMD_compressed_3DC_texture
+#define GL_AMD_compressed_3DC_texture 1
+#define GL_3DC_X_AMD 0x87F9
+#define GL_3DC_XY_AMD 0x87FA
+#define GLEW_AMD_compressed_3DC_texture GLEW_GET_VAR(__GLEW_AMD_compressed_3DC_texture)
+#endif /* GL_AMD_compressed_3DC_texture */
+/* --------------------- GL_AMD_compressed_ATC_texture --------------------- */
+#ifndef GL_AMD_compressed_ATC_texture
+#define GL_AMD_compressed_ATC_texture 1
+#define GL_ATC_RGB_AMD 0x8C92
+#define GLEW_AMD_compressed_ATC_texture GLEW_GET_VAR(__GLEW_AMD_compressed_ATC_texture)
+#endif /* GL_AMD_compressed_ATC_texture */
+/* ----------------------- GL_AMD_conservative_depth ----------------------- */
+#ifndef GL_AMD_conservative_depth
+#define GL_AMD_conservative_depth 1
+#define GLEW_AMD_conservative_depth GLEW_GET_VAR(__GLEW_AMD_conservative_depth)
+#endif /* GL_AMD_conservative_depth */
+/* -------------------------- GL_AMD_debug_output -------------------------- */
+#ifndef GL_AMD_debug_output
+#define GL_AMD_debug_output 1
+typedef void (GLAPIENTRY *GLDEBUGPROCAMD)(GLuint id, GLenum category, GLenum severity, GLsizei length, const GLchar* message, void* userParam);
+typedef void (GLAPIENTRY * PFNGLDEBUGMESSAGEENABLEAMDPROC) (GLenum category, GLenum severity, GLsizei count, const GLuint* ids, GLboolean enabled);
+typedef void (GLAPIENTRY * PFNGLDEBUGMESSAGEINSERTAMDPROC) (GLenum category, GLenum severity, GLuint id, GLsizei length, const GLchar* buf);
+typedef GLuint (GLAPIENTRY * PFNGLGETDEBUGMESSAGELOGAMDPROC) (GLuint count, GLsizei bufsize, GLenum* categories, GLuint* severities, GLuint* ids, GLsizei* lengths, GLchar* message);
+#define glDebugMessageCallbackAMD GLEW_GET_FUN(__glewDebugMessageCallbackAMD)
+#define glDebugMessageEnableAMD GLEW_GET_FUN(__glewDebugMessageEnableAMD)
+#define glDebugMessageInsertAMD GLEW_GET_FUN(__glewDebugMessageInsertAMD)
+#define glGetDebugMessageLogAMD GLEW_GET_FUN(__glewGetDebugMessageLogAMD)
+#define GLEW_AMD_debug_output GLEW_GET_VAR(__GLEW_AMD_debug_output)
+#endif /* GL_AMD_debug_output */
+/* ---------------------- GL_AMD_depth_clamp_separate ---------------------- */
+#ifndef GL_AMD_depth_clamp_separate
+#define GL_AMD_depth_clamp_separate 1
+#define GL_DEPTH_CLAMP_FAR_AMD 0x901F
+#define GLEW_AMD_depth_clamp_separate GLEW_GET_VAR(__GLEW_AMD_depth_clamp_separate)
+#endif /* GL_AMD_depth_clamp_separate */
+/* ----------------------- GL_AMD_draw_buffers_blend ----------------------- */
+#ifndef GL_AMD_draw_buffers_blend
+#define GL_AMD_draw_buffers_blend 1
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCINDEXEDAMDPROC) (GLuint buf, GLenum src, GLenum dst);
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCSEPARATEINDEXEDAMDPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha);
+#define glBlendEquationIndexedAMD GLEW_GET_FUN(__glewBlendEquationIndexedAMD)
+#define glBlendEquationSeparateIndexedAMD GLEW_GET_FUN(__glewBlendEquationSeparateIndexedAMD)
+#define glBlendFuncIndexedAMD GLEW_GET_FUN(__glewBlendFuncIndexedAMD)
+#define glBlendFuncSeparateIndexedAMD GLEW_GET_FUN(__glewBlendFuncSeparateIndexedAMD)
+#define GLEW_AMD_draw_buffers_blend GLEW_GET_VAR(__GLEW_AMD_draw_buffers_blend)
+#endif /* GL_AMD_draw_buffers_blend */
+/* ------------------ GL_AMD_framebuffer_sample_positions ------------------ */
+#ifndef GL_AMD_framebuffer_sample_positions
+#define GL_AMD_framebuffer_sample_positions 1
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERSAMPLEPOSITIONSFVAMDPROC) (GLenum target, GLuint numsamples, GLuint pixelindex, const GLfloat* values);
+typedef void (GLAPIENTRY * PFNGLGETFRAMEBUFFERPARAMETERFVAMDPROC) (GLenum target, GLenum pname, GLuint numsamples, GLuint pixelindex, GLsizei size, GLfloat* values);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDFRAMEBUFFERPARAMETERFVAMDPROC) (GLuint framebuffer, GLenum pname, GLuint numsamples, GLuint pixelindex, GLsizei size, GLfloat* values);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERSAMPLEPOSITIONSFVAMDPROC) (GLuint framebuffer, GLuint numsamples, GLuint pixelindex, const GLfloat* values);
+#define glFramebufferSamplePositionsfvAMD GLEW_GET_FUN(__glewFramebufferSamplePositionsfvAMD)
+#define glGetFramebufferParameterfvAMD GLEW_GET_FUN(__glewGetFramebufferParameterfvAMD)
+#define glGetNamedFramebufferParameterfvAMD GLEW_GET_FUN(__glewGetNamedFramebufferParameterfvAMD)
+#define glNamedFramebufferSamplePositionsfvAMD GLEW_GET_FUN(__glewNamedFramebufferSamplePositionsfvAMD)
+#define GLEW_AMD_framebuffer_sample_positions GLEW_GET_VAR(__GLEW_AMD_framebuffer_sample_positions)
+#endif /* GL_AMD_framebuffer_sample_positions */
+/* --------------------------- GL_AMD_gcn_shader --------------------------- */
+#ifndef GL_AMD_gcn_shader
+#define GL_AMD_gcn_shader 1
+#define GLEW_AMD_gcn_shader GLEW_GET_VAR(__GLEW_AMD_gcn_shader)
+#endif /* GL_AMD_gcn_shader */
+/* ---------------------- GL_AMD_gpu_shader_half_float --------------------- */
+#ifndef GL_AMD_gpu_shader_half_float
+#define GL_AMD_gpu_shader_half_float 1
+#define GL_FLOAT16_NV 0x8FF8
+#define GL_FLOAT16_VEC2_NV 0x8FF9
+#define GL_FLOAT16_VEC3_NV 0x8FFA
+#define GL_FLOAT16_VEC4_NV 0x8FFB
+#define GL_FLOAT16_MAT2_AMD 0x91C5
+#define GL_FLOAT16_MAT3_AMD 0x91C6
+#define GL_FLOAT16_MAT4_AMD 0x91C7
+#define GL_FLOAT16_MAT2x3_AMD 0x91C8
+#define GL_FLOAT16_MAT2x4_AMD 0x91C9
+#define GL_FLOAT16_MAT3x2_AMD 0x91CA
+#define GL_FLOAT16_MAT3x4_AMD 0x91CB
+#define GL_FLOAT16_MAT4x2_AMD 0x91CC
+#define GL_FLOAT16_MAT4x3_AMD 0x91CD
+#define GLEW_AMD_gpu_shader_half_float GLEW_GET_VAR(__GLEW_AMD_gpu_shader_half_float)
+#endif /* GL_AMD_gpu_shader_half_float */
+/* ------------------------ GL_AMD_gpu_shader_int16 ------------------------ */
+#ifndef GL_AMD_gpu_shader_int16
+#define GL_AMD_gpu_shader_int16 1
+#define GLEW_AMD_gpu_shader_int16 GLEW_GET_VAR(__GLEW_AMD_gpu_shader_int16)
+#endif /* GL_AMD_gpu_shader_int16 */
+/* ------------------------ GL_AMD_gpu_shader_int64 ------------------------ */
+#ifndef GL_AMD_gpu_shader_int64
+#define GL_AMD_gpu_shader_int64 1
+#define GLEW_AMD_gpu_shader_int64 GLEW_GET_VAR(__GLEW_AMD_gpu_shader_int64)
+#endif /* GL_AMD_gpu_shader_int64 */
+/* ---------------------- GL_AMD_interleaved_elements ---------------------- */
+#ifndef GL_AMD_interleaved_elements
+#define GL_AMD_interleaved_elements 1
+#define GL_RED 0x1903
+#define GL_GREEN 0x1904
+#define GL_BLUE 0x1905
+#define GL_ALPHA 0x1906
+#define GL_RG8UI 0x8238
+#define GL_RG16UI 0x823A
+#define GL_RGBA8UI 0x8D7C
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBPARAMETERIAMDPROC) (GLuint index, GLenum pname, GLint param);
+#define glVertexAttribParameteriAMD GLEW_GET_FUN(__glewVertexAttribParameteriAMD)
+#define GLEW_AMD_interleaved_elements GLEW_GET_VAR(__GLEW_AMD_interleaved_elements)
+#endif /* GL_AMD_interleaved_elements */
+/* ----------------------- GL_AMD_multi_draw_indirect ---------------------- */
+#ifndef GL_AMD_multi_draw_indirect
+#define GL_AMD_multi_draw_indirect 1
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWARRAYSINDIRECTAMDPROC) (GLenum mode, const void *indirect, GLsizei primcount, GLsizei stride);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSINDIRECTAMDPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei primcount, GLsizei stride);
+#define glMultiDrawArraysIndirectAMD GLEW_GET_FUN(__glewMultiDrawArraysIndirectAMD)
+#define glMultiDrawElementsIndirectAMD GLEW_GET_FUN(__glewMultiDrawElementsIndirectAMD)
+#define GLEW_AMD_multi_draw_indirect GLEW_GET_VAR(__GLEW_AMD_multi_draw_indirect)
+#endif /* GL_AMD_multi_draw_indirect */
+/* ------------------------- GL_AMD_name_gen_delete ------------------------ */
+#ifndef GL_AMD_name_gen_delete
+#define GL_AMD_name_gen_delete 1
+#define GL_DATA_BUFFER_AMD 0x9151
+#define GL_QUERY_OBJECT_AMD 0x9153
+#define GL_SAMPLER_OBJECT_AMD 0x9155
+typedef void (GLAPIENTRY * PFNGLDELETENAMESAMDPROC) (GLenum identifier, GLuint num, const GLuint* names);
+typedef void (GLAPIENTRY * PFNGLGENNAMESAMDPROC) (GLenum identifier, GLuint num, GLuint* names);
+typedef GLboolean (GLAPIENTRY * PFNGLISNAMEAMDPROC) (GLenum identifier, GLuint name);
+#define glDeleteNamesAMD GLEW_GET_FUN(__glewDeleteNamesAMD)
+#define glGenNamesAMD GLEW_GET_FUN(__glewGenNamesAMD)
+#define glIsNameAMD GLEW_GET_FUN(__glewIsNameAMD)
+#define GLEW_AMD_name_gen_delete GLEW_GET_VAR(__GLEW_AMD_name_gen_delete)
+#endif /* GL_AMD_name_gen_delete */
+/* ---------------------- GL_AMD_occlusion_query_event --------------------- */
+#ifndef GL_AMD_occlusion_query_event
+#define GL_AMD_occlusion_query_event 1
+typedef void (GLAPIENTRY * PFNGLQUERYOBJECTPARAMETERUIAMDPROC) (GLenum target, GLuint id, GLenum pname, GLuint param);
+#define glQueryObjectParameteruiAMD GLEW_GET_FUN(__glewQueryObjectParameteruiAMD)
+#define GLEW_AMD_occlusion_query_event GLEW_GET_VAR(__GLEW_AMD_occlusion_query_event)
+#endif /* GL_AMD_occlusion_query_event */
+/* ----------------------- GL_AMD_performance_monitor ---------------------- */
+#ifndef GL_AMD_performance_monitor
+#define GL_AMD_performance_monitor 1
+#define GL_UNSIGNED_INT64_AMD 0x8BC2
+typedef void (GLAPIENTRY * PFNGLDELETEPERFMONITORSAMDPROC) (GLsizei n, GLuint* monitors);
+typedef void (GLAPIENTRY * PFNGLGENPERFMONITORSAMDPROC) (GLsizei n, GLuint* monitors);
+typedef void (GLAPIENTRY * PFNGLGETPERFMONITORCOUNTERDATAAMDPROC) (GLuint monitor, GLenum pname, GLsizei dataSize, GLuint* data, GLint *bytesWritten);
+typedef void (GLAPIENTRY * PFNGLGETPERFMONITORCOUNTERINFOAMDPROC) (GLuint group, GLuint counter, GLenum pname, void *data);
+typedef void (GLAPIENTRY * PFNGLGETPERFMONITORCOUNTERSTRINGAMDPROC) (GLuint group, GLuint counter, GLsizei bufSize, GLsizei* length, GLchar *counterString);
+typedef void (GLAPIENTRY * PFNGLGETPERFMONITORCOUNTERSAMDPROC) (GLuint group, GLint* numCounters, GLint *maxActiveCounters, GLsizei countersSize, GLuint *counters);
+typedef void (GLAPIENTRY * PFNGLGETPERFMONITORGROUPSTRINGAMDPROC) (GLuint group, GLsizei bufSize, GLsizei* length, GLchar *groupString);
+typedef void (GLAPIENTRY * PFNGLGETPERFMONITORGROUPSAMDPROC) (GLint* numGroups, GLsizei groupsSize, GLuint *groups);
+typedef void (GLAPIENTRY * PFNGLSELECTPERFMONITORCOUNTERSAMDPROC) (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint* counterList);
+#define glBeginPerfMonitorAMD GLEW_GET_FUN(__glewBeginPerfMonitorAMD)
+#define glDeletePerfMonitorsAMD GLEW_GET_FUN(__glewDeletePerfMonitorsAMD)
+#define glEndPerfMonitorAMD GLEW_GET_FUN(__glewEndPerfMonitorAMD)
+#define glGenPerfMonitorsAMD GLEW_GET_FUN(__glewGenPerfMonitorsAMD)
+#define glGetPerfMonitorCounterDataAMD GLEW_GET_FUN(__glewGetPerfMonitorCounterDataAMD)
+#define glGetPerfMonitorCounterInfoAMD GLEW_GET_FUN(__glewGetPerfMonitorCounterInfoAMD)
+#define glGetPerfMonitorCounterStringAMD GLEW_GET_FUN(__glewGetPerfMonitorCounterStringAMD)
+#define glGetPerfMonitorCountersAMD GLEW_GET_FUN(__glewGetPerfMonitorCountersAMD)
+#define glGetPerfMonitorGroupStringAMD GLEW_GET_FUN(__glewGetPerfMonitorGroupStringAMD)
+#define glGetPerfMonitorGroupsAMD GLEW_GET_FUN(__glewGetPerfMonitorGroupsAMD)
+#define glSelectPerfMonitorCountersAMD GLEW_GET_FUN(__glewSelectPerfMonitorCountersAMD)
+#define GLEW_AMD_performance_monitor GLEW_GET_VAR(__GLEW_AMD_performance_monitor)
+#endif /* GL_AMD_performance_monitor */
+/* -------------------------- GL_AMD_pinned_memory ------------------------- */
+#ifndef GL_AMD_pinned_memory
+#define GL_AMD_pinned_memory 1
+#define GLEW_AMD_pinned_memory GLEW_GET_VAR(__GLEW_AMD_pinned_memory)
+#endif /* GL_AMD_pinned_memory */
+/* ----------------------- GL_AMD_program_binary_Z400 ---------------------- */
+#ifndef GL_AMD_program_binary_Z400
+#define GL_AMD_program_binary_Z400 1
+#define GL_Z400_BINARY_AMD 0x8740
+#define GLEW_AMD_program_binary_Z400 GLEW_GET_VAR(__GLEW_AMD_program_binary_Z400)
+#endif /* GL_AMD_program_binary_Z400 */
+/* ----------------------- GL_AMD_query_buffer_object ---------------------- */
+#ifndef GL_AMD_query_buffer_object
+#define GL_AMD_query_buffer_object 1
+#define GL_QUERY_BUFFER_AMD 0x9192
+#define GLEW_AMD_query_buffer_object GLEW_GET_VAR(__GLEW_AMD_query_buffer_object)
+#endif /* GL_AMD_query_buffer_object */
+/* ------------------------ GL_AMD_sample_positions ------------------------ */
+#ifndef GL_AMD_sample_positions
+#define GL_AMD_sample_positions 1
+typedef void (GLAPIENTRY * PFNGLSETMULTISAMPLEFVAMDPROC) (GLenum pname, GLuint index, const GLfloat* val);
+#define glSetMultisamplefvAMD GLEW_GET_FUN(__glewSetMultisamplefvAMD)
+#define GLEW_AMD_sample_positions GLEW_GET_VAR(__GLEW_AMD_sample_positions)
+#endif /* GL_AMD_sample_positions */
+/* ------------------ GL_AMD_seamless_cubemap_per_texture ------------------ */
+#ifndef GL_AMD_seamless_cubemap_per_texture
+#define GL_AMD_seamless_cubemap_per_texture 1
+#define GLEW_AMD_seamless_cubemap_per_texture GLEW_GET_VAR(__GLEW_AMD_seamless_cubemap_per_texture)
+#endif /* GL_AMD_seamless_cubemap_per_texture */
+/* -------------------- GL_AMD_shader_atomic_counter_ops ------------------- */
+#ifndef GL_AMD_shader_atomic_counter_ops
+#define GL_AMD_shader_atomic_counter_ops 1
+#define GLEW_AMD_shader_atomic_counter_ops GLEW_GET_VAR(__GLEW_AMD_shader_atomic_counter_ops)
+#endif /* GL_AMD_shader_atomic_counter_ops */
+/* -------------------------- GL_AMD_shader_ballot ------------------------- */
+#ifndef GL_AMD_shader_ballot
+#define GL_AMD_shader_ballot 1
+#define GLEW_AMD_shader_ballot GLEW_GET_VAR(__GLEW_AMD_shader_ballot)
+#endif /* GL_AMD_shader_ballot */
+/* ---------------- GL_AMD_shader_explicit_vertex_parameter ---------------- */
+#ifndef GL_AMD_shader_explicit_vertex_parameter
+#define GL_AMD_shader_explicit_vertex_parameter 1
+#define GLEW_AMD_shader_explicit_vertex_parameter GLEW_GET_VAR(__GLEW_AMD_shader_explicit_vertex_parameter)
+#endif /* GL_AMD_shader_explicit_vertex_parameter */
+/* ---------------------- GL_AMD_shader_stencil_export --------------------- */
+#ifndef GL_AMD_shader_stencil_export
+#define GL_AMD_shader_stencil_export 1
+#define GLEW_AMD_shader_stencil_export GLEW_GET_VAR(__GLEW_AMD_shader_stencil_export)
+#endif /* GL_AMD_shader_stencil_export */
+/* ------------------- GL_AMD_shader_stencil_value_export ------------------ */
+#ifndef GL_AMD_shader_stencil_value_export
+#define GL_AMD_shader_stencil_value_export 1
+#define GLEW_AMD_shader_stencil_value_export GLEW_GET_VAR(__GLEW_AMD_shader_stencil_value_export)
+#endif /* GL_AMD_shader_stencil_value_export */
+/* ---------------------- GL_AMD_shader_trinary_minmax --------------------- */
+#ifndef GL_AMD_shader_trinary_minmax
+#define GL_AMD_shader_trinary_minmax 1
+#define GLEW_AMD_shader_trinary_minmax GLEW_GET_VAR(__GLEW_AMD_shader_trinary_minmax)
+#endif /* GL_AMD_shader_trinary_minmax */
+/* ------------------------- GL_AMD_sparse_texture ------------------------- */
+#ifndef GL_AMD_sparse_texture
+#define GL_AMD_sparse_texture 1
+#define GL_VIRTUAL_PAGE_SIZE_X_AMD 0x9195
+#define GL_VIRTUAL_PAGE_SIZE_Y_AMD 0x9196
+#define GL_VIRTUAL_PAGE_SIZE_Z_AMD 0x9197
+#define GL_MIN_LOD_WARNING_AMD 0x919C
+typedef void (GLAPIENTRY * PFNGLTEXSTORAGESPARSEAMDPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLsizei layers, GLbitfield flags);
+typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGESPARSEAMDPROC) (GLuint texture, GLenum target, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLsizei layers, GLbitfield flags);
+#define glTexStorageSparseAMD GLEW_GET_FUN(__glewTexStorageSparseAMD)
+#define glTextureStorageSparseAMD GLEW_GET_FUN(__glewTextureStorageSparseAMD)
+#define GLEW_AMD_sparse_texture GLEW_GET_VAR(__GLEW_AMD_sparse_texture)
+#endif /* GL_AMD_sparse_texture */
+/* ------------------- GL_AMD_stencil_operation_extended ------------------- */
+#ifndef GL_AMD_stencil_operation_extended
+#define GL_AMD_stencil_operation_extended 1
+#define GL_SET_AMD 0x874A
+#define GL_REPLACE_VALUE_AMD 0x874B
+typedef void (GLAPIENTRY * PFNGLSTENCILOPVALUEAMDPROC) (GLenum face, GLuint value);
+#define glStencilOpValueAMD GLEW_GET_FUN(__glewStencilOpValueAMD)
+#define GLEW_AMD_stencil_operation_extended GLEW_GET_VAR(__GLEW_AMD_stencil_operation_extended)
+#endif /* GL_AMD_stencil_operation_extended */
+/* --------------------- GL_AMD_texture_gather_bias_lod -------------------- */
+#ifndef GL_AMD_texture_gather_bias_lod
+#define GL_AMD_texture_gather_bias_lod 1
+#define GLEW_AMD_texture_gather_bias_lod GLEW_GET_VAR(__GLEW_AMD_texture_gather_bias_lod)
+#endif /* GL_AMD_texture_gather_bias_lod */
+/* ------------------------ GL_AMD_texture_texture4 ------------------------ */
+#ifndef GL_AMD_texture_texture4
+#define GL_AMD_texture_texture4 1
+#define GLEW_AMD_texture_texture4 GLEW_GET_VAR(__GLEW_AMD_texture_texture4)
+#endif /* GL_AMD_texture_texture4 */
+/* --------------- GL_AMD_transform_feedback3_lines_triangles -------------- */
+#ifndef GL_AMD_transform_feedback3_lines_triangles
+#define GL_AMD_transform_feedback3_lines_triangles 1
+#define GLEW_AMD_transform_feedback3_lines_triangles GLEW_GET_VAR(__GLEW_AMD_transform_feedback3_lines_triangles)
+#endif /* GL_AMD_transform_feedback3_lines_triangles */
+/* ----------------------- GL_AMD_transform_feedback4 ---------------------- */
+#ifndef GL_AMD_transform_feedback4
+#define GL_AMD_transform_feedback4 1
+#define GLEW_AMD_transform_feedback4 GLEW_GET_VAR(__GLEW_AMD_transform_feedback4)
+#endif /* GL_AMD_transform_feedback4 */
+/* ----------------------- GL_AMD_vertex_shader_layer ---------------------- */
+#ifndef GL_AMD_vertex_shader_layer
+#define GL_AMD_vertex_shader_layer 1
+#define GLEW_AMD_vertex_shader_layer GLEW_GET_VAR(__GLEW_AMD_vertex_shader_layer)
+#endif /* GL_AMD_vertex_shader_layer */
+/* -------------------- GL_AMD_vertex_shader_tessellator ------------------- */
+#ifndef GL_AMD_vertex_shader_tessellator
+#define GL_AMD_vertex_shader_tessellator 1
+#define GL_SAMPLER_BUFFER_AMD 0x9001
+#define GL_DISCRETE_AMD 0x9006
+#define GL_CONTINUOUS_AMD 0x9007
+#define glTessellationFactorAMD GLEW_GET_FUN(__glewTessellationFactorAMD)
+#define glTessellationModeAMD GLEW_GET_FUN(__glewTessellationModeAMD)
+#define GLEW_AMD_vertex_shader_tessellator GLEW_GET_VAR(__GLEW_AMD_vertex_shader_tessellator)
+#endif /* GL_AMD_vertex_shader_tessellator */
+/* ------------------ GL_AMD_vertex_shader_viewport_index ------------------ */
+#ifndef GL_AMD_vertex_shader_viewport_index
+#define GL_AMD_vertex_shader_viewport_index 1
+#define GLEW_AMD_vertex_shader_viewport_index GLEW_GET_VAR(__GLEW_AMD_vertex_shader_viewport_index)
+#endif /* GL_AMD_vertex_shader_viewport_index */
+/* -------------------- GL_ANDROID_extension_pack_es31a -------------------- */
+#ifndef GL_ANDROID_extension_pack_es31a
+#define GL_ANDROID_extension_pack_es31a 1
+#define GLEW_ANDROID_extension_pack_es31a GLEW_GET_VAR(__GLEW_ANDROID_extension_pack_es31a)
+#endif /* GL_ANDROID_extension_pack_es31a */
+/* ------------------------- GL_ANGLE_depth_texture ------------------------ */
+#ifndef GL_ANGLE_depth_texture
+#define GL_ANGLE_depth_texture 1
+#define GLEW_ANGLE_depth_texture GLEW_GET_VAR(__GLEW_ANGLE_depth_texture)
+#endif /* GL_ANGLE_depth_texture */
+/* ----------------------- GL_ANGLE_framebuffer_blit ----------------------- */
+#ifndef GL_ANGLE_framebuffer_blit
+#define GL_ANGLE_framebuffer_blit 1
+typedef void (GLAPIENTRY * PFNGLBLITFRAMEBUFFERANGLEPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter);
+#define glBlitFramebufferANGLE GLEW_GET_FUN(__glewBlitFramebufferANGLE)
+#define GLEW_ANGLE_framebuffer_blit GLEW_GET_VAR(__GLEW_ANGLE_framebuffer_blit)
+#endif /* GL_ANGLE_framebuffer_blit */
+/* -------------------- GL_ANGLE_framebuffer_multisample ------------------- */
+#ifndef GL_ANGLE_framebuffer_multisample
+#define GL_ANGLE_framebuffer_multisample 1
+#define GL_MAX_SAMPLES_ANGLE 0x8D57
+typedef void (GLAPIENTRY * PFNGLRENDERBUFFERSTORAGEMULTISAMPLEANGLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height);
+#define glRenderbufferStorageMultisampleANGLE GLEW_GET_FUN(__glewRenderbufferStorageMultisampleANGLE)
+#define GLEW_ANGLE_framebuffer_multisample GLEW_GET_VAR(__GLEW_ANGLE_framebuffer_multisample)
+#endif /* GL_ANGLE_framebuffer_multisample */
+/* ----------------------- GL_ANGLE_instanced_arrays ----------------------- */
+#ifndef GL_ANGLE_instanced_arrays
+#define GL_ANGLE_instanced_arrays 1
+typedef void (GLAPIENTRY * PFNGLDRAWARRAYSINSTANCEDANGLEPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDANGLEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBDIVISORANGLEPROC) (GLuint index, GLuint divisor);
+#define glDrawArraysInstancedANGLE GLEW_GET_FUN(__glewDrawArraysInstancedANGLE)
+#define glDrawElementsInstancedANGLE GLEW_GET_FUN(__glewDrawElementsInstancedANGLE)
+#define glVertexAttribDivisorANGLE GLEW_GET_FUN(__glewVertexAttribDivisorANGLE)
+#define GLEW_ANGLE_instanced_arrays GLEW_GET_VAR(__GLEW_ANGLE_instanced_arrays)
+#endif /* GL_ANGLE_instanced_arrays */
+/* -------------------- GL_ANGLE_pack_reverse_row_order -------------------- */
+#ifndef GL_ANGLE_pack_reverse_row_order
+#define GL_ANGLE_pack_reverse_row_order 1
+#define GLEW_ANGLE_pack_reverse_row_order GLEW_GET_VAR(__GLEW_ANGLE_pack_reverse_row_order)
+#endif /* GL_ANGLE_pack_reverse_row_order */
+/* ------------------------ GL_ANGLE_program_binary ------------------------ */
+#ifndef GL_ANGLE_program_binary
+#define GL_ANGLE_program_binary 1
+#define GLEW_ANGLE_program_binary GLEW_GET_VAR(__GLEW_ANGLE_program_binary)
+#endif /* GL_ANGLE_program_binary */
+/* ------------------- GL_ANGLE_texture_compression_dxt1 ------------------- */
+#ifndef GL_ANGLE_texture_compression_dxt1
+#define GL_ANGLE_texture_compression_dxt1 1
+#define GLEW_ANGLE_texture_compression_dxt1 GLEW_GET_VAR(__GLEW_ANGLE_texture_compression_dxt1)
+#endif /* GL_ANGLE_texture_compression_dxt1 */
+/* ------------------- GL_ANGLE_texture_compression_dxt3 ------------------- */
+#ifndef GL_ANGLE_texture_compression_dxt3
+#define GL_ANGLE_texture_compression_dxt3 1
+#define GLEW_ANGLE_texture_compression_dxt3 GLEW_GET_VAR(__GLEW_ANGLE_texture_compression_dxt3)
+#endif /* GL_ANGLE_texture_compression_dxt3 */
+/* ------------------- GL_ANGLE_texture_compression_dxt5 ------------------- */
+#ifndef GL_ANGLE_texture_compression_dxt5
+#define GL_ANGLE_texture_compression_dxt5 1
+#define GLEW_ANGLE_texture_compression_dxt5 GLEW_GET_VAR(__GLEW_ANGLE_texture_compression_dxt5)
+#endif /* GL_ANGLE_texture_compression_dxt5 */
+/* ------------------------- GL_ANGLE_texture_usage ------------------------ */
+#ifndef GL_ANGLE_texture_usage
+#define GL_ANGLE_texture_usage 1
+#define GLEW_ANGLE_texture_usage GLEW_GET_VAR(__GLEW_ANGLE_texture_usage)
+#endif /* GL_ANGLE_texture_usage */
+/* -------------------------- GL_ANGLE_timer_query ------------------------- */
+#ifndef GL_ANGLE_timer_query
+#define GL_ANGLE_timer_query 1
+#define GL_CURRENT_QUERY_ANGLE 0x8865
+#define GL_QUERY_RESULT_ANGLE 0x8866
+#define GL_TIMESTAMP_ANGLE 0x8E28
+typedef void (GLAPIENTRY * PFNGLBEGINQUERYANGLEPROC) (GLenum target, GLuint id);
+typedef void (GLAPIENTRY * PFNGLDELETEQUERIESANGLEPROC) (GLsizei n, const GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLENDQUERYANGLEPROC) (GLenum target);
+typedef void (GLAPIENTRY * PFNGLGENQUERIESANGLEPROC) (GLsizei n, GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTI64VANGLEPROC) (GLuint id, GLenum pname, GLint64* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTIVANGLEPROC) (GLuint id, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTUI64VANGLEPROC) (GLuint id, GLenum pname, GLuint64* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTUIVANGLEPROC) (GLuint id, GLenum pname, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYIVANGLEPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLQUERYCOUNTERANGLEPROC) (GLuint id, GLenum target);
+#define glBeginQueryANGLE GLEW_GET_FUN(__glewBeginQueryANGLE)
+#define glDeleteQueriesANGLE GLEW_GET_FUN(__glewDeleteQueriesANGLE)
+#define glEndQueryANGLE GLEW_GET_FUN(__glewEndQueryANGLE)
+#define glGenQueriesANGLE GLEW_GET_FUN(__glewGenQueriesANGLE)
+#define glGetQueryObjecti64vANGLE GLEW_GET_FUN(__glewGetQueryObjecti64vANGLE)
+#define glGetQueryObjectivANGLE GLEW_GET_FUN(__glewGetQueryObjectivANGLE)
+#define glGetQueryObjectui64vANGLE GLEW_GET_FUN(__glewGetQueryObjectui64vANGLE)
+#define glGetQueryObjectuivANGLE GLEW_GET_FUN(__glewGetQueryObjectuivANGLE)
+#define glGetQueryivANGLE GLEW_GET_FUN(__glewGetQueryivANGLE)
+#define glIsQueryANGLE GLEW_GET_FUN(__glewIsQueryANGLE)
+#define glQueryCounterANGLE GLEW_GET_FUN(__glewQueryCounterANGLE)
+#define GLEW_ANGLE_timer_query GLEW_GET_VAR(__GLEW_ANGLE_timer_query)
+#endif /* GL_ANGLE_timer_query */
+/* ------------------- GL_ANGLE_translated_shader_source ------------------- */
+#ifndef GL_ANGLE_translated_shader_source
+#define GL_ANGLE_translated_shader_source 1
+typedef void (GLAPIENTRY * PFNGLGETTRANSLATEDSHADERSOURCEANGLEPROC) (GLuint shader, GLsizei bufsize, GLsizei* length, GLchar* source);
+#define glGetTranslatedShaderSourceANGLE GLEW_GET_FUN(__glewGetTranslatedShaderSourceANGLE)
+#define GLEW_ANGLE_translated_shader_source GLEW_GET_VAR(__GLEW_ANGLE_translated_shader_source)
+#endif /* GL_ANGLE_translated_shader_source */
+/* ----------------------- GL_APPLE_aux_depth_stencil ---------------------- */
+#ifndef GL_APPLE_aux_depth_stencil
+#define GL_APPLE_aux_depth_stencil 1
+#define GLEW_APPLE_aux_depth_stencil GLEW_GET_VAR(__GLEW_APPLE_aux_depth_stencil)
+#endif /* GL_APPLE_aux_depth_stencil */
+/* ------------------------ GL_APPLE_client_storage ------------------------ */
+#ifndef GL_APPLE_client_storage
+#define GL_APPLE_client_storage 1
+#define GLEW_APPLE_client_storage GLEW_GET_VAR(__GLEW_APPLE_client_storage)
+#endif /* GL_APPLE_client_storage */
+/* ------------------------- GL_APPLE_clip_distance ------------------------ */
+#ifndef GL_APPLE_clip_distance
+#define GL_APPLE_clip_distance 1
+#define GL_CLIP_DISTANCE0_APPLE 0x3000
+#define GL_CLIP_DISTANCE1_APPLE 0x3001
+#define GL_CLIP_DISTANCE2_APPLE 0x3002
+#define GL_CLIP_DISTANCE3_APPLE 0x3003
+#define GL_CLIP_DISTANCE4_APPLE 0x3004
+#define GL_CLIP_DISTANCE5_APPLE 0x3005
+#define GL_CLIP_DISTANCE6_APPLE 0x3006
+#define GL_CLIP_DISTANCE7_APPLE 0x3007
+#define GLEW_APPLE_clip_distance GLEW_GET_VAR(__GLEW_APPLE_clip_distance)
+#endif /* GL_APPLE_clip_distance */
+/* ------------------- GL_APPLE_color_buffer_packed_float ------------------ */
+#ifndef GL_APPLE_color_buffer_packed_float
+#define GL_APPLE_color_buffer_packed_float 1
+#define GLEW_APPLE_color_buffer_packed_float GLEW_GET_VAR(__GLEW_APPLE_color_buffer_packed_float)
+#endif /* GL_APPLE_color_buffer_packed_float */
+/* ---------------------- GL_APPLE_copy_texture_levels --------------------- */
+#ifndef GL_APPLE_copy_texture_levels
+#define GL_APPLE_copy_texture_levels 1
+typedef void (GLAPIENTRY * PFNGLCOPYTEXTURELEVELSAPPLEPROC) (GLuint destinationTexture, GLuint sourceTexture, GLint sourceBaseLevel, GLsizei sourceLevelCount);
+#define glCopyTextureLevelsAPPLE GLEW_GET_FUN(__glewCopyTextureLevelsAPPLE)
+#define GLEW_APPLE_copy_texture_levels GLEW_GET_VAR(__GLEW_APPLE_copy_texture_levels)
+#endif /* GL_APPLE_copy_texture_levels */
+/* ------------------------- GL_APPLE_element_array ------------------------ */
+#ifndef GL_APPLE_element_array
+#define GL_APPLE_element_array 1
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, GLint first, GLsizei count);
+typedef void (GLAPIENTRY * PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count);
+typedef void (GLAPIENTRY * PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const void *pointer);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, const GLint* first, const GLsizei *count, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, const GLint* first, const GLsizei *count, GLsizei primcount);
+#define glDrawElementArrayAPPLE GLEW_GET_FUN(__glewDrawElementArrayAPPLE)
+#define glDrawRangeElementArrayAPPLE GLEW_GET_FUN(__glewDrawRangeElementArrayAPPLE)
+#define glElementPointerAPPLE GLEW_GET_FUN(__glewElementPointerAPPLE)
+#define glMultiDrawElementArrayAPPLE GLEW_GET_FUN(__glewMultiDrawElementArrayAPPLE)
+#define glMultiDrawRangeElementArrayAPPLE GLEW_GET_FUN(__glewMultiDrawRangeElementArrayAPPLE)
+#define GLEW_APPLE_element_array GLEW_GET_VAR(__GLEW_APPLE_element_array)
+#endif /* GL_APPLE_element_array */
+/* ----------------------------- GL_APPLE_fence ---------------------------- */
+#ifndef GL_APPLE_fence
+#define GL_APPLE_fence 1
+#define GL_FENCE_APPLE 0x8A0B
+typedef void (GLAPIENTRY * PFNGLDELETEFENCESAPPLEPROC) (GLsizei n, const GLuint* fences);
+typedef void (GLAPIENTRY * PFNGLFINISHOBJECTAPPLEPROC) (GLenum object, GLint name);
+typedef void (GLAPIENTRY * PFNGLGENFENCESAPPLEPROC) (GLsizei n, GLuint* fences);
+typedef GLboolean (GLAPIENTRY * PFNGLISFENCEAPPLEPROC) (GLuint fence);
+typedef GLboolean (GLAPIENTRY * PFNGLTESTOBJECTAPPLEPROC) (GLenum object, GLuint name);
+#define glDeleteFencesAPPLE GLEW_GET_FUN(__glewDeleteFencesAPPLE)
+#define glFinishFenceAPPLE GLEW_GET_FUN(__glewFinishFenceAPPLE)
+#define glFinishObjectAPPLE GLEW_GET_FUN(__glewFinishObjectAPPLE)
+#define glGenFencesAPPLE GLEW_GET_FUN(__glewGenFencesAPPLE)
+#define glIsFenceAPPLE GLEW_GET_FUN(__glewIsFenceAPPLE)
+#define glSetFenceAPPLE GLEW_GET_FUN(__glewSetFenceAPPLE)
+#define glTestFenceAPPLE GLEW_GET_FUN(__glewTestFenceAPPLE)
+#define glTestObjectAPPLE GLEW_GET_FUN(__glewTestObjectAPPLE)
+#define GLEW_APPLE_fence GLEW_GET_VAR(__GLEW_APPLE_fence)
+#endif /* GL_APPLE_fence */
+/* ------------------------- GL_APPLE_float_pixels ------------------------- */
+#ifndef GL_APPLE_float_pixels
+#define GL_APPLE_float_pixels 1
+#define GL_HALF_APPLE 0x140B
+#define GL_RGBA_FLOAT32_APPLE 0x8814
+#define GL_RGB_FLOAT32_APPLE 0x8815
+#define GL_ALPHA_FLOAT32_APPLE 0x8816
+#define GL_INTENSITY_FLOAT32_APPLE 0x8817
+#define GL_LUMINANCE_FLOAT32_APPLE 0x8818
+#define GL_RGBA_FLOAT16_APPLE 0x881A
+#define GL_RGB_FLOAT16_APPLE 0x881B
+#define GL_ALPHA_FLOAT16_APPLE 0x881C
+#define GLEW_APPLE_float_pixels GLEW_GET_VAR(__GLEW_APPLE_float_pixels)
+#endif /* GL_APPLE_float_pixels */
+/* ---------------------- GL_APPLE_flush_buffer_range ---------------------- */
+#ifndef GL_APPLE_flush_buffer_range
+#define GL_APPLE_flush_buffer_range 1
+typedef void (GLAPIENTRY * PFNGLBUFFERPARAMETERIAPPLEPROC) (GLenum target, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLFLUSHMAPPEDBUFFERRANGEAPPLEPROC) (GLenum target, GLintptr offset, GLsizeiptr size);
+#define glBufferParameteriAPPLE GLEW_GET_FUN(__glewBufferParameteriAPPLE)
+#define glFlushMappedBufferRangeAPPLE GLEW_GET_FUN(__glewFlushMappedBufferRangeAPPLE)
+#define GLEW_APPLE_flush_buffer_range GLEW_GET_VAR(__GLEW_APPLE_flush_buffer_range)
+#endif /* GL_APPLE_flush_buffer_range */
+/* -------------------- GL_APPLE_framebuffer_multisample ------------------- */
+#ifndef GL_APPLE_framebuffer_multisample
+#define GL_APPLE_framebuffer_multisample 1
+#define GL_MAX_SAMPLES_APPLE 0x8D57
+typedef void (GLAPIENTRY * PFNGLRENDERBUFFERSTORAGEMULTISAMPLEAPPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height);
+#define glRenderbufferStorageMultisampleAPPLE GLEW_GET_FUN(__glewRenderbufferStorageMultisampleAPPLE)
+#define glResolveMultisampleFramebufferAPPLE GLEW_GET_FUN(__glewResolveMultisampleFramebufferAPPLE)
+#define GLEW_APPLE_framebuffer_multisample GLEW_GET_VAR(__GLEW_APPLE_framebuffer_multisample)
+#endif /* GL_APPLE_framebuffer_multisample */
+/* ----------------------- GL_APPLE_object_purgeable ----------------------- */
+#ifndef GL_APPLE_object_purgeable
+#define GL_APPLE_object_purgeable 1
+#define GL_RELEASED_APPLE 0x8A19
+typedef void (GLAPIENTRY * PFNGLGETOBJECTPARAMETERIVAPPLEPROC) (GLenum objectType, GLuint name, GLenum pname, GLint* params);
+typedef GLenum (GLAPIENTRY * PFNGLOBJECTPURGEABLEAPPLEPROC) (GLenum objectType, GLuint name, GLenum option);
+typedef GLenum (GLAPIENTRY * PFNGLOBJECTUNPURGEABLEAPPLEPROC) (GLenum objectType, GLuint name, GLenum option);
+#define glGetObjectParameterivAPPLE GLEW_GET_FUN(__glewGetObjectParameterivAPPLE)
+#define glObjectPurgeableAPPLE GLEW_GET_FUN(__glewObjectPurgeableAPPLE)
+#define glObjectUnpurgeableAPPLE GLEW_GET_FUN(__glewObjectUnpurgeableAPPLE)
+#define GLEW_APPLE_object_purgeable GLEW_GET_VAR(__GLEW_APPLE_object_purgeable)
+#endif /* GL_APPLE_object_purgeable */
+/* ------------------------- GL_APPLE_pixel_buffer ------------------------- */
+#ifndef GL_APPLE_pixel_buffer
+#define GL_APPLE_pixel_buffer 1
+#define GLEW_APPLE_pixel_buffer GLEW_GET_VAR(__GLEW_APPLE_pixel_buffer)
+#endif /* GL_APPLE_pixel_buffer */
+/* ---------------------------- GL_APPLE_rgb_422 --------------------------- */
+#ifndef GL_APPLE_rgb_422
+#define GL_APPLE_rgb_422 1
+#define GL_RGB_422_APPLE 0x8A1F
+#define GL_RGB_RAW_422_APPLE 0x8A51
+#define GLEW_APPLE_rgb_422 GLEW_GET_VAR(__GLEW_APPLE_rgb_422)
+#endif /* GL_APPLE_rgb_422 */
+/* --------------------------- GL_APPLE_row_bytes -------------------------- */
+#ifndef GL_APPLE_row_bytes
+#define GL_APPLE_row_bytes 1
+#define GLEW_APPLE_row_bytes GLEW_GET_VAR(__GLEW_APPLE_row_bytes)
+#endif /* GL_APPLE_row_bytes */
+/* ------------------------ GL_APPLE_specular_vector ----------------------- */
+#ifndef GL_APPLE_specular_vector
+#define GL_APPLE_specular_vector 1
+#define GLEW_APPLE_specular_vector GLEW_GET_VAR(__GLEW_APPLE_specular_vector)
+#endif /* GL_APPLE_specular_vector */
+/* ----------------------------- GL_APPLE_sync ----------------------------- */
+#ifndef GL_APPLE_sync
+#define GL_APPLE_sync 1
+#define GL_SYNC_OBJECT_APPLE 0x8A53
+#define GL_OBJECT_TYPE_APPLE 0x9112
+#define GL_SYNC_STATUS_APPLE 0x9114
+#define GL_SYNC_FLAGS_APPLE 0x9115
+#define GL_SYNC_FENCE_APPLE 0x9116
+#define GL_UNSIGNALED_APPLE 0x9118
+#define GL_SIGNALED_APPLE 0x9119
+#define GL_WAIT_FAILED_APPLE 0x911D
+typedef GLenum (GLAPIENTRY * PFNGLCLIENTWAITSYNCAPPLEPROC) (GLsync GLsync, GLbitfield flags, GLuint64 timeout);
+typedef GLsync (GLAPIENTRY * PFNGLFENCESYNCAPPLEPROC) (GLenum condition, GLbitfield flags);
+typedef void (GLAPIENTRY * PFNGLGETINTEGER64VAPPLEPROC) (GLenum pname, GLint64* params);
+typedef void (GLAPIENTRY * PFNGLGETSYNCIVAPPLEPROC) (GLsync GLsync, GLenum pname, GLsizei bufSize, GLsizei* length, GLint *values);
+typedef void (GLAPIENTRY * PFNGLWAITSYNCAPPLEPROC) (GLsync GLsync, GLbitfield flags, GLuint64 timeout);
+#define glClientWaitSyncAPPLE GLEW_GET_FUN(__glewClientWaitSyncAPPLE)
+#define glDeleteSyncAPPLE GLEW_GET_FUN(__glewDeleteSyncAPPLE)
+#define glFenceSyncAPPLE GLEW_GET_FUN(__glewFenceSyncAPPLE)
+#define glGetInteger64vAPPLE GLEW_GET_FUN(__glewGetInteger64vAPPLE)
+#define glGetSyncivAPPLE GLEW_GET_FUN(__glewGetSyncivAPPLE)
+#define glIsSyncAPPLE GLEW_GET_FUN(__glewIsSyncAPPLE)
+#define glWaitSyncAPPLE GLEW_GET_FUN(__glewWaitSyncAPPLE)
+#define GLEW_APPLE_sync GLEW_GET_VAR(__GLEW_APPLE_sync)
+#endif /* GL_APPLE_sync */
+/* -------------------- GL_APPLE_texture_2D_limited_npot ------------------- */
+#ifndef GL_APPLE_texture_2D_limited_npot
+#define GL_APPLE_texture_2D_limited_npot 1
+#define GLEW_APPLE_texture_2D_limited_npot GLEW_GET_VAR(__GLEW_APPLE_texture_2D_limited_npot)
+#endif /* GL_APPLE_texture_2D_limited_npot */
+/* -------------------- GL_APPLE_texture_format_BGRA8888 ------------------- */
+#ifndef GL_APPLE_texture_format_BGRA8888
+#define GL_APPLE_texture_format_BGRA8888 1
+#define GL_BGRA_EXT 0x80E1
+#define GL_BGRA8_EXT 0x93A1
+#define GLEW_APPLE_texture_format_BGRA8888 GLEW_GET_VAR(__GLEW_APPLE_texture_format_BGRA8888)
+#endif /* GL_APPLE_texture_format_BGRA8888 */
+/* ----------------------- GL_APPLE_texture_max_level ---------------------- */
+#ifndef GL_APPLE_texture_max_level
+#define GL_APPLE_texture_max_level 1
+#define GLEW_APPLE_texture_max_level GLEW_GET_VAR(__GLEW_APPLE_texture_max_level)
+#endif /* GL_APPLE_texture_max_level */
+/* --------------------- GL_APPLE_texture_packed_float --------------------- */
+#ifndef GL_APPLE_texture_packed_float
+#define GL_APPLE_texture_packed_float 1
+#define GL_R11F_G11F_B10F_APPLE 0x8C3A
+#define GL_UNSIGNED_INT_10F_11F_11F_REV_APPLE 0x8C3B
+#define GL_RGB9_E5_APPLE 0x8C3D
+#define GL_UNSIGNED_INT_5_9_9_9_REV_APPLE 0x8C3E
+#define GLEW_APPLE_texture_packed_float GLEW_GET_VAR(__GLEW_APPLE_texture_packed_float)
+#endif /* GL_APPLE_texture_packed_float */
+/* ------------------------- GL_APPLE_texture_range ------------------------ */
+#ifndef GL_APPLE_texture_range
+#define GL_APPLE_texture_range 1
+typedef void (GLAPIENTRY * PFNGLGETTEXPARAMETERPOINTERVAPPLEPROC) (GLenum target, GLenum pname, void **params);
+typedef void (GLAPIENTRY * PFNGLTEXTURERANGEAPPLEPROC) (GLenum target, GLsizei length, void *pointer);
+#define glGetTexParameterPointervAPPLE GLEW_GET_FUN(__glewGetTexParameterPointervAPPLE)
+#define glTextureRangeAPPLE GLEW_GET_FUN(__glewTextureRangeAPPLE)
+#define GLEW_APPLE_texture_range GLEW_GET_VAR(__GLEW_APPLE_texture_range)
+#endif /* GL_APPLE_texture_range */
+/* ------------------------ GL_APPLE_transform_hint ------------------------ */
+#ifndef GL_APPLE_transform_hint
+#define GL_APPLE_transform_hint 1
+#define GLEW_APPLE_transform_hint GLEW_GET_VAR(__GLEW_APPLE_transform_hint)
+#endif /* GL_APPLE_transform_hint */
+/* ---------------------- GL_APPLE_vertex_array_object --------------------- */
+#ifndef GL_APPLE_vertex_array_object
+#define GL_APPLE_vertex_array_object 1
+typedef void (GLAPIENTRY * PFNGLDELETEVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint* arrays);
+typedef void (GLAPIENTRY * PFNGLGENVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint* arrays);
+#define glBindVertexArrayAPPLE GLEW_GET_FUN(__glewBindVertexArrayAPPLE)
+#define glDeleteVertexArraysAPPLE GLEW_GET_FUN(__glewDeleteVertexArraysAPPLE)
+#define glGenVertexArraysAPPLE GLEW_GET_FUN(__glewGenVertexArraysAPPLE)
+#define glIsVertexArrayAPPLE GLEW_GET_FUN(__glewIsVertexArrayAPPLE)
+#define GLEW_APPLE_vertex_array_object GLEW_GET_VAR(__GLEW_APPLE_vertex_array_object)
+#endif /* GL_APPLE_vertex_array_object */
+/* ---------------------- GL_APPLE_vertex_array_range ---------------------- */
+#ifndef GL_APPLE_vertex_array_range
+#define GL_APPLE_vertex_array_range 1
+typedef void (GLAPIENTRY * PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, void *pointer);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, void *pointer);
+#define glFlushVertexArrayRangeAPPLE GLEW_GET_FUN(__glewFlushVertexArrayRangeAPPLE)
+#define glVertexArrayParameteriAPPLE GLEW_GET_FUN(__glewVertexArrayParameteriAPPLE)
+#define glVertexArrayRangeAPPLE GLEW_GET_FUN(__glewVertexArrayRangeAPPLE)
+#define GLEW_APPLE_vertex_array_range GLEW_GET_VAR(__GLEW_APPLE_vertex_array_range)
+#endif /* GL_APPLE_vertex_array_range */
+/* ------------------- GL_APPLE_vertex_program_evaluators ------------------ */
+#ifndef GL_APPLE_vertex_program_evaluators
+#define GL_APPLE_vertex_program_evaluators 1
+typedef void (GLAPIENTRY * PFNGLMAPVERTEXATTRIB1DAPPLEPROC) (GLuint index, GLuint size, GLdouble u1, GLdouble u2, GLint stride, GLint order, const GLdouble* points);
+typedef void (GLAPIENTRY * PFNGLMAPVERTEXATTRIB1FAPPLEPROC) (GLuint index, GLuint size, GLfloat u1, GLfloat u2, GLint stride, GLint order, const GLfloat* points);
+typedef void (GLAPIENTRY * PFNGLMAPVERTEXATTRIB2DAPPLEPROC) (GLuint index, GLuint size, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, const GLdouble* points);
+typedef void (GLAPIENTRY * PFNGLMAPVERTEXATTRIB2FAPPLEPROC) (GLuint index, GLuint size, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, const GLfloat* points);
+#define glDisableVertexAttribAPPLE GLEW_GET_FUN(__glewDisableVertexAttribAPPLE)
+#define glEnableVertexAttribAPPLE GLEW_GET_FUN(__glewEnableVertexAttribAPPLE)
+#define glIsVertexAttribEnabledAPPLE GLEW_GET_FUN(__glewIsVertexAttribEnabledAPPLE)
+#define glMapVertexAttrib1dAPPLE GLEW_GET_FUN(__glewMapVertexAttrib1dAPPLE)
+#define glMapVertexAttrib1fAPPLE GLEW_GET_FUN(__glewMapVertexAttrib1fAPPLE)
+#define glMapVertexAttrib2dAPPLE GLEW_GET_FUN(__glewMapVertexAttrib2dAPPLE)
+#define glMapVertexAttrib2fAPPLE GLEW_GET_FUN(__glewMapVertexAttrib2fAPPLE)
+#define GLEW_APPLE_vertex_program_evaluators GLEW_GET_VAR(__GLEW_APPLE_vertex_program_evaluators)
+#endif /* GL_APPLE_vertex_program_evaluators */
+/* --------------------------- GL_APPLE_ycbcr_422 -------------------------- */
+#ifndef GL_APPLE_ycbcr_422
+#define GL_APPLE_ycbcr_422 1
+#define GL_YCBCR_422_APPLE 0x85B9
+#define GLEW_APPLE_ycbcr_422 GLEW_GET_VAR(__GLEW_APPLE_ycbcr_422)
+#endif /* GL_APPLE_ycbcr_422 */
+/* ------------------------ GL_ARB_ES2_compatibility ----------------------- */
+#ifndef GL_ARB_ES2_compatibility
+#define GL_ARB_ES2_compatibility 1
+#define GL_FIXED 0x140C
+#define GL_RGB565 0x8D62
+#define GL_LOW_FLOAT 0x8DF0
+#define GL_MEDIUM_FLOAT 0x8DF1
+#define GL_HIGH_FLOAT 0x8DF2
+#define GL_LOW_INT 0x8DF3
+#define GL_MEDIUM_INT 0x8DF4
+#define GL_HIGH_INT 0x8DF5
+typedef int GLfixed;
+typedef void (GLAPIENTRY * PFNGLDEPTHRANGEFPROC) (GLclampf n, GLclampf f);
+typedef void (GLAPIENTRY * PFNGLGETSHADERPRECISIONFORMATPROC) (GLenum shadertype, GLenum precisiontype, GLint* range, GLint *precision);
+typedef void (GLAPIENTRY * PFNGLSHADERBINARYPROC) (GLsizei count, const GLuint* shaders, GLenum binaryformat, const void*binary, GLsizei length);
+#define glClearDepthf GLEW_GET_FUN(__glewClearDepthf)
+#define glDepthRangef GLEW_GET_FUN(__glewDepthRangef)
+#define glGetShaderPrecisionFormat GLEW_GET_FUN(__glewGetShaderPrecisionFormat)
+#define glReleaseShaderCompiler GLEW_GET_FUN(__glewReleaseShaderCompiler)
+#define glShaderBinary GLEW_GET_FUN(__glewShaderBinary)
+#define GLEW_ARB_ES2_compatibility GLEW_GET_VAR(__GLEW_ARB_ES2_compatibility)
+#endif /* GL_ARB_ES2_compatibility */
+/* ----------------------- GL_ARB_ES3_1_compatibility ---------------------- */
+#ifndef GL_ARB_ES3_1_compatibility
+#define GL_ARB_ES3_1_compatibility 1
+#define glMemoryBarrierByRegion GLEW_GET_FUN(__glewMemoryBarrierByRegion)
+#define GLEW_ARB_ES3_1_compatibility GLEW_GET_VAR(__GLEW_ARB_ES3_1_compatibility)
+#endif /* GL_ARB_ES3_1_compatibility */
+/* ----------------------- GL_ARB_ES3_2_compatibility ---------------------- */
+#ifndef GL_ARB_ES3_2_compatibility
+#define GL_ARB_ES3_2_compatibility 1
+typedef void (GLAPIENTRY * PFNGLPRIMITIVEBOUNDINGBOXARBPROC) (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW);
+#define glPrimitiveBoundingBoxARB GLEW_GET_FUN(__glewPrimitiveBoundingBoxARB)
+#define GLEW_ARB_ES3_2_compatibility GLEW_GET_VAR(__GLEW_ARB_ES3_2_compatibility)
+#endif /* GL_ARB_ES3_2_compatibility */
+/* ------------------------ GL_ARB_ES3_compatibility ----------------------- */
+#ifndef GL_ARB_ES3_compatibility
+#define GL_ARB_ES3_compatibility 1
+#define GL_COMPRESSED_R11_EAC 0x9270
+#define GL_COMPRESSED_SIGNED_R11_EAC 0x9271
+#define GL_COMPRESSED_RG11_EAC 0x9272
+#define GL_COMPRESSED_RGB8_ETC2 0x9274
+#define GL_COMPRESSED_SRGB8_ETC2 0x9275
+#define GL_COMPRESSED_RGBA8_ETC2_EAC 0x9278
+#define GLEW_ARB_ES3_compatibility GLEW_GET_VAR(__GLEW_ARB_ES3_compatibility)
+#endif /* GL_ARB_ES3_compatibility */
+/* ------------------------ GL_ARB_arrays_of_arrays ------------------------ */
+#ifndef GL_ARB_arrays_of_arrays
+#define GL_ARB_arrays_of_arrays 1
+#define GLEW_ARB_arrays_of_arrays GLEW_GET_VAR(__GLEW_ARB_arrays_of_arrays)
+#endif /* GL_ARB_arrays_of_arrays */
+/* -------------------------- GL_ARB_base_instance ------------------------- */
+#ifndef GL_ARB_base_instance
+#define GL_ARB_base_instance 1
+typedef void (GLAPIENTRY * PFNGLDRAWARRAYSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount, GLuint baseinstance);
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount, GLuint baseinstance);
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount, GLint basevertex, GLuint baseinstance);
+#define glDrawArraysInstancedBaseInstance GLEW_GET_FUN(__glewDrawArraysInstancedBaseInstance)
+#define glDrawElementsInstancedBaseInstance GLEW_GET_FUN(__glewDrawElementsInstancedBaseInstance)
+#define glDrawElementsInstancedBaseVertexBaseInstance GLEW_GET_FUN(__glewDrawElementsInstancedBaseVertexBaseInstance)
+#define GLEW_ARB_base_instance GLEW_GET_VAR(__GLEW_ARB_base_instance)
+#endif /* GL_ARB_base_instance */
+/* ------------------------ GL_ARB_bindless_texture ------------------------ */
+#ifndef GL_ARB_bindless_texture
+#define GL_ARB_bindless_texture 1
+#define GL_UNSIGNED_INT64_ARB 0x140F
+typedef GLuint64 (GLAPIENTRY * PFNGLGETIMAGEHANDLEARBPROC) (GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum format);
+typedef GLuint64 (GLAPIENTRY * PFNGLGETTEXTURESAMPLERHANDLEARBPROC) (GLuint texture, GLuint sampler);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBLUI64VARBPROC) (GLuint index, GLenum pname, GLuint64EXT* params);
+typedef void (GLAPIENTRY * PFNGLMAKEIMAGEHANDLERESIDENTARBPROC) (GLuint64 handle, GLenum access);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMHANDLEUI64ARBPROC) (GLuint program, GLint location, GLuint64 value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMHANDLEUI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64* values);
+typedef void (GLAPIENTRY * PFNGLUNIFORMHANDLEUI64ARBPROC) (GLint location, GLuint64 value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMHANDLEUI64VARBPROC) (GLint location, GLsizei count, const GLuint64* value);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBL1UI64ARBPROC) (GLuint index, GLuint64EXT x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBL1UI64VARBPROC) (GLuint index, const GLuint64EXT* v);
+#define glGetImageHandleARB GLEW_GET_FUN(__glewGetImageHandleARB)
+#define glGetTextureHandleARB GLEW_GET_FUN(__glewGetTextureHandleARB)
+#define glGetTextureSamplerHandleARB GLEW_GET_FUN(__glewGetTextureSamplerHandleARB)
+#define glGetVertexAttribLui64vARB GLEW_GET_FUN(__glewGetVertexAttribLui64vARB)
+#define glIsImageHandleResidentARB GLEW_GET_FUN(__glewIsImageHandleResidentARB)
+#define glIsTextureHandleResidentARB GLEW_GET_FUN(__glewIsTextureHandleResidentARB)
+#define glMakeImageHandleNonResidentARB GLEW_GET_FUN(__glewMakeImageHandleNonResidentARB)
+#define glMakeImageHandleResidentARB GLEW_GET_FUN(__glewMakeImageHandleResidentARB)
+#define glMakeTextureHandleNonResidentARB GLEW_GET_FUN(__glewMakeTextureHandleNonResidentARB)
+#define glMakeTextureHandleResidentARB GLEW_GET_FUN(__glewMakeTextureHandleResidentARB)
+#define glProgramUniformHandleui64ARB GLEW_GET_FUN(__glewProgramUniformHandleui64ARB)
+#define glProgramUniformHandleui64vARB GLEW_GET_FUN(__glewProgramUniformHandleui64vARB)
+#define glUniformHandleui64ARB GLEW_GET_FUN(__glewUniformHandleui64ARB)
+#define glUniformHandleui64vARB GLEW_GET_FUN(__glewUniformHandleui64vARB)
+#define glVertexAttribL1ui64ARB GLEW_GET_FUN(__glewVertexAttribL1ui64ARB)
+#define glVertexAttribL1ui64vARB GLEW_GET_FUN(__glewVertexAttribL1ui64vARB)
+#define GLEW_ARB_bindless_texture GLEW_GET_VAR(__GLEW_ARB_bindless_texture)
+#endif /* GL_ARB_bindless_texture */
+/* ----------------------- GL_ARB_blend_func_extended ---------------------- */
+#ifndef GL_ARB_blend_func_extended
+#define GL_ARB_blend_func_extended 1
+#define GL_SRC1_COLOR 0x88F9
+typedef void (GLAPIENTRY * PFNGLBINDFRAGDATALOCATIONINDEXEDPROC) (GLuint program, GLuint colorNumber, GLuint index, const GLchar * name);
+typedef GLint (GLAPIENTRY * PFNGLGETFRAGDATAINDEXPROC) (GLuint program, const GLchar * name);
+#define glBindFragDataLocationIndexed GLEW_GET_FUN(__glewBindFragDataLocationIndexed)
+#define glGetFragDataIndex GLEW_GET_FUN(__glewGetFragDataIndex)
+#define GLEW_ARB_blend_func_extended GLEW_GET_VAR(__GLEW_ARB_blend_func_extended)
+#endif /* GL_ARB_blend_func_extended */
+/* ------------------------- GL_ARB_buffer_storage ------------------------- */
+#ifndef GL_ARB_buffer_storage
+#define GL_ARB_buffer_storage 1
+#define GL_MAP_READ_BIT 0x0001
+#define GL_MAP_WRITE_BIT 0x0002
+#define GL_MAP_PERSISTENT_BIT 0x00000040
+#define GL_MAP_COHERENT_BIT 0x00000080
+#define GL_DYNAMIC_STORAGE_BIT 0x0100
+#define GL_CLIENT_STORAGE_BIT 0x0200
+typedef void (GLAPIENTRY * PFNGLBUFFERSTORAGEPROC) (GLenum target, GLsizeiptr size, const void *data, GLbitfield flags);
+#define glBufferStorage GLEW_GET_FUN(__glewBufferStorage)
+#define GLEW_ARB_buffer_storage GLEW_GET_VAR(__GLEW_ARB_buffer_storage)
+#endif /* GL_ARB_buffer_storage */
+/* ---------------------------- GL_ARB_cl_event ---------------------------- */
+#ifndef GL_ARB_cl_event
+#define GL_ARB_cl_event 1
+#define GL_SYNC_CL_EVENT_ARB 0x8240
+typedef struct _cl_context *cl_context;
+typedef struct _cl_event *cl_event;
+typedef GLsync (GLAPIENTRY * PFNGLCREATESYNCFROMCLEVENTARBPROC) (cl_context context, cl_event event, GLbitfield flags);
+#define glCreateSyncFromCLeventARB GLEW_GET_FUN(__glewCreateSyncFromCLeventARB)
+#define GLEW_ARB_cl_event GLEW_GET_VAR(__GLEW_ARB_cl_event)
+#endif /* GL_ARB_cl_event */
+/* ----------------------- GL_ARB_clear_buffer_object ---------------------- */
+#ifndef GL_ARB_clear_buffer_object
+#define GL_ARB_clear_buffer_object 1
+typedef void (GLAPIENTRY * PFNGLCLEARBUFFERDATAPROC) (GLenum target, GLenum internalformat, GLenum format, GLenum type, const void *data);
+typedef void (GLAPIENTRY * PFNGLCLEARBUFFERSUBDATAPROC) (GLenum target, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data);
+typedef void (GLAPIENTRY * PFNGLCLEARNAMEDBUFFERDATAEXTPROC) (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data);
+typedef void (GLAPIENTRY * PFNGLCLEARNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data);
+#define glClearBufferData GLEW_GET_FUN(__glewClearBufferData)
+#define glClearBufferSubData GLEW_GET_FUN(__glewClearBufferSubData)
+#define glClearNamedBufferDataEXT GLEW_GET_FUN(__glewClearNamedBufferDataEXT)
+#define glClearNamedBufferSubDataEXT GLEW_GET_FUN(__glewClearNamedBufferSubDataEXT)
+#define GLEW_ARB_clear_buffer_object GLEW_GET_VAR(__GLEW_ARB_clear_buffer_object)
+#endif /* GL_ARB_clear_buffer_object */
+/* -------------------------- GL_ARB_clear_texture ------------------------- */
+#ifndef GL_ARB_clear_texture
+#define GL_ARB_clear_texture 1
+#define GL_CLEAR_TEXTURE 0x9365
+typedef void (GLAPIENTRY * PFNGLCLEARTEXIMAGEPROC) (GLuint texture, GLint level, GLenum format, GLenum type, const void *data);
+typedef void (GLAPIENTRY * PFNGLCLEARTEXSUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *data);
+#define glClearTexImage GLEW_GET_FUN(__glewClearTexImage)
+#define glClearTexSubImage GLEW_GET_FUN(__glewClearTexSubImage)
+#define GLEW_ARB_clear_texture GLEW_GET_VAR(__GLEW_ARB_clear_texture)
+#endif /* GL_ARB_clear_texture */
+/* -------------------------- GL_ARB_clip_control -------------------------- */
+#ifndef GL_ARB_clip_control
+#define GL_ARB_clip_control 1
+#define GL_LOWER_LEFT 0x8CA1
+#define GL_UPPER_LEFT 0x8CA2
+#define GL_CLIP_ORIGIN 0x935C
+#define GL_CLIP_DEPTH_MODE 0x935D
+#define GL_NEGATIVE_ONE_TO_ONE 0x935E
+#define GL_ZERO_TO_ONE 0x935F
+typedef void (GLAPIENTRY * PFNGLCLIPCONTROLPROC) (GLenum origin, GLenum depth);
+#define glClipControl GLEW_GET_FUN(__glewClipControl)
+#define GLEW_ARB_clip_control GLEW_GET_VAR(__GLEW_ARB_clip_control)
+#endif /* GL_ARB_clip_control */
+/* ----------------------- GL_ARB_color_buffer_float ----------------------- */
+#ifndef GL_ARB_color_buffer_float
+#define GL_ARB_color_buffer_float 1
+#define GL_RGBA_FLOAT_MODE_ARB 0x8820
+#define GL_FIXED_ONLY_ARB 0x891D
+typedef void (GLAPIENTRY * PFNGLCLAMPCOLORARBPROC) (GLenum target, GLenum clamp);
+#define glClampColorARB GLEW_GET_FUN(__glewClampColorARB)
+#define GLEW_ARB_color_buffer_float GLEW_GET_VAR(__GLEW_ARB_color_buffer_float)
+#endif /* GL_ARB_color_buffer_float */
+/* -------------------------- GL_ARB_compatibility ------------------------- */
+#ifndef GL_ARB_compatibility
+#define GL_ARB_compatibility 1
+#define GLEW_ARB_compatibility GLEW_GET_VAR(__GLEW_ARB_compatibility)
+#endif /* GL_ARB_compatibility */
+/* ---------------- GL_ARB_compressed_texture_pixel_storage ---------------- */
+#ifndef GL_ARB_compressed_texture_pixel_storage
+#define GL_ARB_compressed_texture_pixel_storage 1
+#define GLEW_ARB_compressed_texture_pixel_storage GLEW_GET_VAR(__GLEW_ARB_compressed_texture_pixel_storage)
+#endif /* GL_ARB_compressed_texture_pixel_storage */
+/* ------------------------- GL_ARB_compute_shader ------------------------- */
+#ifndef GL_ARB_compute_shader
+#define GL_ARB_compute_shader 1
+#define GL_COMPUTE_SHADER_BIT 0x00000020
+#define GL_COMPUTE_SHADER 0x91B9
+typedef void (GLAPIENTRY * PFNGLDISPATCHCOMPUTEPROC) (GLuint num_groups_x, GLuint num_groups_y, GLuint num_groups_z);
+#define glDispatchCompute GLEW_GET_FUN(__glewDispatchCompute)
+#define glDispatchComputeIndirect GLEW_GET_FUN(__glewDispatchComputeIndirect)
+#define GLEW_ARB_compute_shader GLEW_GET_VAR(__GLEW_ARB_compute_shader)
+#endif /* GL_ARB_compute_shader */
+/* ------------------- GL_ARB_compute_variable_group_size ------------------ */
+#ifndef GL_ARB_compute_variable_group_size
+#define GL_ARB_compute_variable_group_size 1
+typedef void (GLAPIENTRY * PFNGLDISPATCHCOMPUTEGROUPSIZEARBPROC) (GLuint num_groups_x, GLuint num_groups_y, GLuint num_groups_z, GLuint group_size_x, GLuint group_size_y, GLuint group_size_z);
+#define glDispatchComputeGroupSizeARB GLEW_GET_FUN(__glewDispatchComputeGroupSizeARB)
+#define GLEW_ARB_compute_variable_group_size GLEW_GET_VAR(__GLEW_ARB_compute_variable_group_size)
+#endif /* GL_ARB_compute_variable_group_size */
+/* ------------------- GL_ARB_conditional_render_inverted ------------------ */
+#ifndef GL_ARB_conditional_render_inverted
+#define GL_ARB_conditional_render_inverted 1
+#define GLEW_ARB_conditional_render_inverted GLEW_GET_VAR(__GLEW_ARB_conditional_render_inverted)
+#endif /* GL_ARB_conditional_render_inverted */
+/* ----------------------- GL_ARB_conservative_depth ----------------------- */
+#ifndef GL_ARB_conservative_depth
+#define GL_ARB_conservative_depth 1
+#define GLEW_ARB_conservative_depth GLEW_GET_VAR(__GLEW_ARB_conservative_depth)
+#endif /* GL_ARB_conservative_depth */
+/* --------------------------- GL_ARB_copy_buffer -------------------------- */
+#ifndef GL_ARB_copy_buffer
+#define GL_ARB_copy_buffer 1
+#define GL_COPY_READ_BUFFER 0x8F36
+#define GL_COPY_WRITE_BUFFER 0x8F37
+typedef void (GLAPIENTRY * PFNGLCOPYBUFFERSUBDATAPROC) (GLenum readtarget, GLenum writetarget, GLintptr readoffset, GLintptr writeoffset, GLsizeiptr size);
+#define glCopyBufferSubData GLEW_GET_FUN(__glewCopyBufferSubData)
+#define GLEW_ARB_copy_buffer GLEW_GET_VAR(__GLEW_ARB_copy_buffer)
+#endif /* GL_ARB_copy_buffer */
+/* --------------------------- GL_ARB_copy_image --------------------------- */
+#ifndef GL_ARB_copy_image
+#define GL_ARB_copy_image 1
+typedef void (GLAPIENTRY * PFNGLCOPYIMAGESUBDATAPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth);
+#define glCopyImageSubData GLEW_GET_FUN(__glewCopyImageSubData)
+#define GLEW_ARB_copy_image GLEW_GET_VAR(__GLEW_ARB_copy_image)
+#endif /* GL_ARB_copy_image */
+/* -------------------------- GL_ARB_cull_distance ------------------------- */
+#ifndef GL_ARB_cull_distance
+#define GL_ARB_cull_distance 1
+#define GLEW_ARB_cull_distance GLEW_GET_VAR(__GLEW_ARB_cull_distance)
+#endif /* GL_ARB_cull_distance */
+/* -------------------------- GL_ARB_debug_output -------------------------- */
+#ifndef GL_ARB_debug_output
+#define GL_ARB_debug_output 1
+#define GL_DEBUG_SOURCE_API_ARB 0x8246
+#define GL_DEBUG_TYPE_OTHER_ARB 0x8251
+typedef void (GLAPIENTRY *GLDEBUGPROCARB)(GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar* message, const void* userParam);
+typedef void (GLAPIENTRY * PFNGLDEBUGMESSAGECONTROLARBPROC) (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint* ids, GLboolean enabled);
+typedef void (GLAPIENTRY * PFNGLDEBUGMESSAGEINSERTARBPROC) (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar* buf);
+typedef GLuint (GLAPIENTRY * PFNGLGETDEBUGMESSAGELOGARBPROC) (GLuint count, GLsizei bufSize, GLenum* sources, GLenum* types, GLuint* ids, GLenum* severities, GLsizei* lengths, GLchar* messageLog);
+#define glDebugMessageCallbackARB GLEW_GET_FUN(__glewDebugMessageCallbackARB)
+#define glDebugMessageControlARB GLEW_GET_FUN(__glewDebugMessageControlARB)
+#define glDebugMessageInsertARB GLEW_GET_FUN(__glewDebugMessageInsertARB)
+#define glGetDebugMessageLogARB GLEW_GET_FUN(__glewGetDebugMessageLogARB)
+#define GLEW_ARB_debug_output GLEW_GET_VAR(__GLEW_ARB_debug_output)
+#endif /* GL_ARB_debug_output */
+/* ----------------------- GL_ARB_depth_buffer_float ----------------------- */
+#ifndef GL_ARB_depth_buffer_float
+#define GL_ARB_depth_buffer_float 1
+#define GL_DEPTH32F_STENCIL8 0x8CAD
+#define GL_FLOAT_32_UNSIGNED_INT_24_8_REV 0x8DAD
+#define GLEW_ARB_depth_buffer_float GLEW_GET_VAR(__GLEW_ARB_depth_buffer_float)
+#endif /* GL_ARB_depth_buffer_float */
+/* --------------------------- GL_ARB_depth_clamp -------------------------- */
+#ifndef GL_ARB_depth_clamp
+#define GL_ARB_depth_clamp 1
+#define GL_DEPTH_CLAMP 0x864F
+#define GLEW_ARB_depth_clamp GLEW_GET_VAR(__GLEW_ARB_depth_clamp)
+#endif /* GL_ARB_depth_clamp */
+/* -------------------------- GL_ARB_depth_texture ------------------------- */
+#ifndef GL_ARB_depth_texture
+#define GL_ARB_depth_texture 1
+#define GL_DEPTH_COMPONENT16_ARB 0x81A5
+#define GL_DEPTH_COMPONENT24_ARB 0x81A6
+#define GL_DEPTH_COMPONENT32_ARB 0x81A7
+#define GLEW_ARB_depth_texture GLEW_GET_VAR(__GLEW_ARB_depth_texture)
+#endif /* GL_ARB_depth_texture */
+/* ----------------------- GL_ARB_derivative_control ----------------------- */
+#ifndef GL_ARB_derivative_control
+#define GL_ARB_derivative_control 1
+#define GLEW_ARB_derivative_control GLEW_GET_VAR(__GLEW_ARB_derivative_control)
+#endif /* GL_ARB_derivative_control */
+/* ----------------------- GL_ARB_direct_state_access ---------------------- */
+#ifndef GL_ARB_direct_state_access
+#define GL_ARB_direct_state_access 1
+#define GL_TEXTURE_TARGET 0x1006
+#define GL_QUERY_TARGET 0x82EA
+typedef void (GLAPIENTRY * PFNGLBINDTEXTUREUNITPROC) (GLuint unit, GLuint texture);
+typedef void (GLAPIENTRY * PFNGLBLITNAMEDFRAMEBUFFERPROC) (GLuint readFramebuffer, GLuint drawFramebuffer, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter);
+typedef GLenum (GLAPIENTRY * PFNGLCHECKNAMEDFRAMEBUFFERSTATUSPROC) (GLuint framebuffer, GLenum target);
+typedef void (GLAPIENTRY * PFNGLCLEARNAMEDBUFFERDATAPROC) (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data);
+typedef void (GLAPIENTRY * PFNGLCLEARNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data);
+typedef void (GLAPIENTRY * PFNGLCLEARNAMEDFRAMEBUFFERFIPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, GLfloat depth, GLint stencil);
+typedef void (GLAPIENTRY * PFNGLCLEARNAMEDFRAMEBUFFERFVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLCLEARNAMEDFRAMEBUFFERIVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLCLEARNAMEDFRAMEBUFFERUIVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOPYNAMEDBUFFERSUBDATAPROC) (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLCREATEBUFFERSPROC) (GLsizei n, GLuint* buffers);
+typedef void (GLAPIENTRY * PFNGLCREATEFRAMEBUFFERSPROC) (GLsizei n, GLuint* framebuffers);
+typedef void (GLAPIENTRY * PFNGLCREATEPROGRAMPIPELINESPROC) (GLsizei n, GLuint* pipelines);
+typedef void (GLAPIENTRY * PFNGLCREATEQUERIESPROC) (GLenum target, GLsizei n, GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLCREATERENDERBUFFERSPROC) (GLsizei n, GLuint* renderbuffers);
+typedef void (GLAPIENTRY * PFNGLCREATESAMPLERSPROC) (GLsizei n, GLuint* samplers);
+typedef void (GLAPIENTRY * PFNGLCREATETEXTURESPROC) (GLenum target, GLsizei n, GLuint* textures);
+typedef void (GLAPIENTRY * PFNGLCREATEVERTEXARRAYSPROC) (GLsizei n, GLuint* arrays);
+typedef void (GLAPIENTRY * PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length);
+typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXTUREIMAGEPROC) (GLuint texture, GLint level, GLsizei bufSize, void *pixels);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDBUFFERPARAMETERI64VPROC) (GLuint buffer, GLenum pname, GLint64* params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDBUFFERPARAMETERIVPROC) (GLuint buffer, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDBUFFERPOINTERVPROC) (GLuint buffer, GLenum pname, void** params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDFRAMEBUFFERATTACHMENTPARAMETERIVPROC) (GLuint framebuffer, GLenum attachment, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDFRAMEBUFFERPARAMETERIVPROC) (GLuint framebuffer, GLenum pname, GLint* param);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDRENDERBUFFERPARAMETERIVPROC) (GLuint renderbuffer, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYBUFFEROBJECTI64VPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLGETQUERYBUFFEROBJECTIVPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLGETQUERYBUFFEROBJECTUI64VPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLGETQUERYBUFFEROBJECTUIVPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLGETTEXTUREIMAGEPROC) (GLuint texture, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels);
+typedef void (GLAPIENTRY * PFNGLGETTEXTURELEVELPARAMETERFVPROC) (GLuint texture, GLint level, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXTURELEVELPARAMETERIVPROC) (GLuint texture, GLint level, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXTUREPARAMETERIIVPROC) (GLuint texture, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXTUREPARAMETERIUIVPROC) (GLuint texture, GLenum pname, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXTUREPARAMETERFVPROC) (GLuint texture, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXTUREPARAMETERIVPROC) (GLuint texture, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETTRANSFORMFEEDBACKI64_VPROC) (GLuint xfb, GLenum pname, GLuint index, GLint64* param);
+typedef void (GLAPIENTRY * PFNGLGETTRANSFORMFEEDBACKI_VPROC) (GLuint xfb, GLenum pname, GLuint index, GLint* param);
+typedef void (GLAPIENTRY * PFNGLGETTRANSFORMFEEDBACKIVPROC) (GLuint xfb, GLenum pname, GLint* param);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXARRAYINDEXED64IVPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint64* param);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXARRAYINDEXEDIVPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint* param);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXARRAYIVPROC) (GLuint vaobj, GLenum pname, GLint* param);
+typedef void (GLAPIENTRY * PFNGLINVALIDATENAMEDFRAMEBUFFERDATAPROC) (GLuint framebuffer, GLsizei numAttachments, const GLenum* attachments);
+typedef void (GLAPIENTRY * PFNGLINVALIDATENAMEDFRAMEBUFFERSUBDATAPROC) (GLuint framebuffer, GLsizei numAttachments, const GLenum* attachments, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void * (GLAPIENTRY * PFNGLMAPNAMEDBUFFERPROC) (GLuint buffer, GLenum access);
+typedef void * (GLAPIENTRY * PFNGLMAPNAMEDBUFFERRANGEPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access);
+typedef void (GLAPIENTRY * PFNGLNAMEDBUFFERDATAPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage);
+typedef void (GLAPIENTRY * PFNGLNAMEDBUFFERSTORAGEPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags);
+typedef void (GLAPIENTRY * PFNGLNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERDRAWBUFFERPROC) (GLuint framebuffer, GLenum mode);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERDRAWBUFFERSPROC) (GLuint framebuffer, GLsizei n, const GLenum* bufs);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERPARAMETERIPROC) (GLuint framebuffer, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERREADBUFFERPROC) (GLuint framebuffer, GLenum mode);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERRENDERBUFFERPROC) (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERTEXTUREPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERTEXTURELAYERPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer);
+typedef void (GLAPIENTRY * PFNGLNAMEDRENDERBUFFERSTORAGEPROC) (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEPROC) (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLTEXTUREBUFFERPROC) (GLuint texture, GLenum internalformat, GLuint buffer);
+typedef void (GLAPIENTRY * PFNGLTEXTUREBUFFERRANGEPROC) (GLuint texture, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERIIVPROC) (GLuint texture, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERIUIVPROC) (GLuint texture, GLenum pname, const GLuint* params);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERFPROC) (GLuint texture, GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERFVPROC) (GLuint texture, GLenum pname, const GLfloat* param);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERIPROC) (GLuint texture, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERIVPROC) (GLuint texture, GLenum pname, const GLint* param);
+typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE1DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE2DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE2DMULTISAMPLEPROC) (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations);
+typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE3DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth);
+typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE3DMULTISAMPLEPROC) (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations);
+typedef void (GLAPIENTRY * PFNGLTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLTRANSFORMFEEDBACKBUFFERBASEPROC) (GLuint xfb, GLuint index, GLuint buffer);
+typedef void (GLAPIENTRY * PFNGLTRANSFORMFEEDBACKBUFFERRANGEPROC) (GLuint xfb, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYATTRIBBINDINGPROC) (GLuint vaobj, GLuint attribindex, GLuint bindingindex);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYATTRIBFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYATTRIBIFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYATTRIBLFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYBINDINGDIVISORPROC) (GLuint vaobj, GLuint bindingindex, GLuint divisor);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXBUFFERPROC) (GLuint vaobj, GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXBUFFERSPROC) (GLuint vaobj, GLuint first, GLsizei count, const GLuint* buffers, const GLintptr *offsets, const GLsizei *strides);
+#define glBindTextureUnit GLEW_GET_FUN(__glewBindTextureUnit)
+#define glBlitNamedFramebuffer GLEW_GET_FUN(__glewBlitNamedFramebuffer)
+#define glCheckNamedFramebufferStatus GLEW_GET_FUN(__glewCheckNamedFramebufferStatus)
+#define glClearNamedBufferData GLEW_GET_FUN(__glewClearNamedBufferData)
+#define glClearNamedBufferSubData GLEW_GET_FUN(__glewClearNamedBufferSubData)
+#define glClearNamedFramebufferfi GLEW_GET_FUN(__glewClearNamedFramebufferfi)
+#define glClearNamedFramebufferfv GLEW_GET_FUN(__glewClearNamedFramebufferfv)
+#define glClearNamedFramebufferiv GLEW_GET_FUN(__glewClearNamedFramebufferiv)
+#define glClearNamedFramebufferuiv GLEW_GET_FUN(__glewClearNamedFramebufferuiv)
+#define glCompressedTextureSubImage1D GLEW_GET_FUN(__glewCompressedTextureSubImage1D)
+#define glCompressedTextureSubImage2D GLEW_GET_FUN(__glewCompressedTextureSubImage2D)
+#define glCompressedTextureSubImage3D GLEW_GET_FUN(__glewCompressedTextureSubImage3D)
+#define glCopyNamedBufferSubData GLEW_GET_FUN(__glewCopyNamedBufferSubData)
+#define glCopyTextureSubImage1D GLEW_GET_FUN(__glewCopyTextureSubImage1D)
+#define glCopyTextureSubImage2D GLEW_GET_FUN(__glewCopyTextureSubImage2D)
+#define glCopyTextureSubImage3D GLEW_GET_FUN(__glewCopyTextureSubImage3D)
+#define glCreateBuffers GLEW_GET_FUN(__glewCreateBuffers)
+#define glCreateFramebuffers GLEW_GET_FUN(__glewCreateFramebuffers)
+#define glCreateProgramPipelines GLEW_GET_FUN(__glewCreateProgramPipelines)
+#define glCreateQueries GLEW_GET_FUN(__glewCreateQueries)
+#define glCreateRenderbuffers GLEW_GET_FUN(__glewCreateRenderbuffers)
+#define glCreateSamplers GLEW_GET_FUN(__glewCreateSamplers)
+#define glCreateTextures GLEW_GET_FUN(__glewCreateTextures)
+#define glCreateTransformFeedbacks GLEW_GET_FUN(__glewCreateTransformFeedbacks)
+#define glCreateVertexArrays GLEW_GET_FUN(__glewCreateVertexArrays)
+#define glDisableVertexArrayAttrib GLEW_GET_FUN(__glewDisableVertexArrayAttrib)
+#define glEnableVertexArrayAttrib GLEW_GET_FUN(__glewEnableVertexArrayAttrib)
+#define glFlushMappedNamedBufferRange GLEW_GET_FUN(__glewFlushMappedNamedBufferRange)
+#define glGenerateTextureMipmap GLEW_GET_FUN(__glewGenerateTextureMipmap)
+#define glGetCompressedTextureImage GLEW_GET_FUN(__glewGetCompressedTextureImage)
+#define glGetNamedBufferParameteri64v GLEW_GET_FUN(__glewGetNamedBufferParameteri64v)
+#define glGetNamedBufferParameteriv GLEW_GET_FUN(__glewGetNamedBufferParameteriv)
+#define glGetNamedBufferPointerv GLEW_GET_FUN(__glewGetNamedBufferPointerv)
+#define glGetNamedBufferSubData GLEW_GET_FUN(__glewGetNamedBufferSubData)
+#define glGetNamedFramebufferAttachmentParameteriv GLEW_GET_FUN(__glewGetNamedFramebufferAttachmentParameteriv)
+#define glGetNamedFramebufferParameteriv GLEW_GET_FUN(__glewGetNamedFramebufferParameteriv)
+#define glGetNamedRenderbufferParameteriv GLEW_GET_FUN(__glewGetNamedRenderbufferParameteriv)
+#define glGetQueryBufferObjecti64v GLEW_GET_FUN(__glewGetQueryBufferObjecti64v)
+#define glGetQueryBufferObjectiv GLEW_GET_FUN(__glewGetQueryBufferObjectiv)
+#define glGetQueryBufferObjectui64v GLEW_GET_FUN(__glewGetQueryBufferObjectui64v)
+#define glGetQueryBufferObjectuiv GLEW_GET_FUN(__glewGetQueryBufferObjectuiv)
+#define glGetTextureImage GLEW_GET_FUN(__glewGetTextureImage)
+#define glGetTextureLevelParameterfv GLEW_GET_FUN(__glewGetTextureLevelParameterfv)
+#define glGetTextureLevelParameteriv GLEW_GET_FUN(__glewGetTextureLevelParameteriv)
+#define glGetTextureParameterIiv GLEW_GET_FUN(__glewGetTextureParameterIiv)
+#define glGetTextureParameterIuiv GLEW_GET_FUN(__glewGetTextureParameterIuiv)
+#define glGetTextureParameterfv GLEW_GET_FUN(__glewGetTextureParameterfv)
+#define glGetTextureParameteriv GLEW_GET_FUN(__glewGetTextureParameteriv)
+#define glGetTransformFeedbacki64_v GLEW_GET_FUN(__glewGetTransformFeedbacki64_v)
+#define glGetTransformFeedbacki_v GLEW_GET_FUN(__glewGetTransformFeedbacki_v)
+#define glGetTransformFeedbackiv GLEW_GET_FUN(__glewGetTransformFeedbackiv)
+#define glGetVertexArrayIndexed64iv GLEW_GET_FUN(__glewGetVertexArrayIndexed64iv)
+#define glGetVertexArrayIndexediv GLEW_GET_FUN(__glewGetVertexArrayIndexediv)
+#define glGetVertexArrayiv GLEW_GET_FUN(__glewGetVertexArrayiv)
+#define glInvalidateNamedFramebufferData GLEW_GET_FUN(__glewInvalidateNamedFramebufferData)
+#define glInvalidateNamedFramebufferSubData GLEW_GET_FUN(__glewInvalidateNamedFramebufferSubData)
+#define glMapNamedBuffer GLEW_GET_FUN(__glewMapNamedBuffer)
+#define glMapNamedBufferRange GLEW_GET_FUN(__glewMapNamedBufferRange)
+#define glNamedBufferData GLEW_GET_FUN(__glewNamedBufferData)
+#define glNamedBufferStorage GLEW_GET_FUN(__glewNamedBufferStorage)
+#define glNamedBufferSubData GLEW_GET_FUN(__glewNamedBufferSubData)
+#define glNamedFramebufferDrawBuffer GLEW_GET_FUN(__glewNamedFramebufferDrawBuffer)
+#define glNamedFramebufferDrawBuffers GLEW_GET_FUN(__glewNamedFramebufferDrawBuffers)
+#define glNamedFramebufferParameteri GLEW_GET_FUN(__glewNamedFramebufferParameteri)
+#define glNamedFramebufferReadBuffer GLEW_GET_FUN(__glewNamedFramebufferReadBuffer)
+#define glNamedFramebufferRenderbuffer GLEW_GET_FUN(__glewNamedFramebufferRenderbuffer)
+#define glNamedFramebufferTexture GLEW_GET_FUN(__glewNamedFramebufferTexture)
+#define glNamedFramebufferTextureLayer GLEW_GET_FUN(__glewNamedFramebufferTextureLayer)
+#define glNamedRenderbufferStorage GLEW_GET_FUN(__glewNamedRenderbufferStorage)
+#define glNamedRenderbufferStorageMultisample GLEW_GET_FUN(__glewNamedRenderbufferStorageMultisample)
+#define glTextureBuffer GLEW_GET_FUN(__glewTextureBuffer)
+#define glTextureBufferRange GLEW_GET_FUN(__glewTextureBufferRange)
+#define glTextureParameterIiv GLEW_GET_FUN(__glewTextureParameterIiv)
+#define glTextureParameterIuiv GLEW_GET_FUN(__glewTextureParameterIuiv)
+#define glTextureParameterf GLEW_GET_FUN(__glewTextureParameterf)
+#define glTextureParameterfv GLEW_GET_FUN(__glewTextureParameterfv)
+#define glTextureParameteri GLEW_GET_FUN(__glewTextureParameteri)
+#define glTextureParameteriv GLEW_GET_FUN(__glewTextureParameteriv)
+#define glTextureStorage1D GLEW_GET_FUN(__glewTextureStorage1D)
+#define glTextureStorage2D GLEW_GET_FUN(__glewTextureStorage2D)
+#define glTextureStorage2DMultisample GLEW_GET_FUN(__glewTextureStorage2DMultisample)
+#define glTextureStorage3D GLEW_GET_FUN(__glewTextureStorage3D)
+#define glTextureStorage3DMultisample GLEW_GET_FUN(__glewTextureStorage3DMultisample)
+#define glTextureSubImage1D GLEW_GET_FUN(__glewTextureSubImage1D)
+#define glTextureSubImage2D GLEW_GET_FUN(__glewTextureSubImage2D)
+#define glTextureSubImage3D GLEW_GET_FUN(__glewTextureSubImage3D)
+#define glTransformFeedbackBufferBase GLEW_GET_FUN(__glewTransformFeedbackBufferBase)
+#define glTransformFeedbackBufferRange GLEW_GET_FUN(__glewTransformFeedbackBufferRange)
+#define glUnmapNamedBuffer GLEW_GET_FUN(__glewUnmapNamedBuffer)
+#define glVertexArrayAttribBinding GLEW_GET_FUN(__glewVertexArrayAttribBinding)
+#define glVertexArrayAttribFormat GLEW_GET_FUN(__glewVertexArrayAttribFormat)
+#define glVertexArrayAttribIFormat GLEW_GET_FUN(__glewVertexArrayAttribIFormat)
+#define glVertexArrayAttribLFormat GLEW_GET_FUN(__glewVertexArrayAttribLFormat)
+#define glVertexArrayBindingDivisor GLEW_GET_FUN(__glewVertexArrayBindingDivisor)
+#define glVertexArrayElementBuffer GLEW_GET_FUN(__glewVertexArrayElementBuffer)
+#define glVertexArrayVertexBuffer GLEW_GET_FUN(__glewVertexArrayVertexBuffer)
+#define glVertexArrayVertexBuffers GLEW_GET_FUN(__glewVertexArrayVertexBuffers)
+#define GLEW_ARB_direct_state_access GLEW_GET_VAR(__GLEW_ARB_direct_state_access)
+#endif /* GL_ARB_direct_state_access */
+/* -------------------------- GL_ARB_draw_buffers -------------------------- */
+#ifndef GL_ARB_draw_buffers
+#define GL_ARB_draw_buffers 1
+#define GL_MAX_DRAW_BUFFERS_ARB 0x8824
+#define GL_DRAW_BUFFER0_ARB 0x8825
+#define GL_DRAW_BUFFER1_ARB 0x8826
+#define GL_DRAW_BUFFER2_ARB 0x8827
+#define GL_DRAW_BUFFER3_ARB 0x8828
+#define GL_DRAW_BUFFER4_ARB 0x8829
+#define GL_DRAW_BUFFER5_ARB 0x882A
+#define GL_DRAW_BUFFER6_ARB 0x882B
+#define GL_DRAW_BUFFER7_ARB 0x882C
+#define GL_DRAW_BUFFER8_ARB 0x882D
+#define GL_DRAW_BUFFER9_ARB 0x882E
+#define GL_DRAW_BUFFER10_ARB 0x882F
+#define GL_DRAW_BUFFER11_ARB 0x8830
+#define GL_DRAW_BUFFER12_ARB 0x8831
+#define GL_DRAW_BUFFER13_ARB 0x8832
+#define GL_DRAW_BUFFER14_ARB 0x8833
+#define GL_DRAW_BUFFER15_ARB 0x8834
+typedef void (GLAPIENTRY * PFNGLDRAWBUFFERSARBPROC) (GLsizei n, const GLenum* bufs);
+#define glDrawBuffersARB GLEW_GET_FUN(__glewDrawBuffersARB)
+#define GLEW_ARB_draw_buffers GLEW_GET_VAR(__GLEW_ARB_draw_buffers)
+#endif /* GL_ARB_draw_buffers */
+/* ----------------------- GL_ARB_draw_buffers_blend ----------------------- */
+#ifndef GL_ARB_draw_buffers_blend
+#define GL_ARB_draw_buffers_blend 1
+typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONSEPARATEIARBPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha);
+typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONIARBPROC) (GLuint buf, GLenum mode);
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCSEPARATEIARBPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha);
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCIARBPROC) (GLuint buf, GLenum src, GLenum dst);
+#define glBlendEquationSeparateiARB GLEW_GET_FUN(__glewBlendEquationSeparateiARB)
+#define glBlendEquationiARB GLEW_GET_FUN(__glewBlendEquationiARB)
+#define glBlendFuncSeparateiARB GLEW_GET_FUN(__glewBlendFuncSeparateiARB)
+#define glBlendFunciARB GLEW_GET_FUN(__glewBlendFunciARB)
+#define GLEW_ARB_draw_buffers_blend GLEW_GET_VAR(__GLEW_ARB_draw_buffers_blend)
+#endif /* GL_ARB_draw_buffers_blend */
+/* -------------------- GL_ARB_draw_elements_base_vertex ------------------- */
+#ifndef GL_ARB_draw_elements_base_vertex
+#define GL_ARB_draw_elements_base_vertex 1
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, void *indices, GLint basevertex);
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount, GLint basevertex);
+typedef void (GLAPIENTRY * PFNGLDRAWRANGEELEMENTSBASEVERTEXPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, void *indices, GLint basevertex);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, GLsizei* count, GLenum type, void**indices, GLsizei primcount, GLint *basevertex);
+#define glDrawElementsBaseVertex GLEW_GET_FUN(__glewDrawElementsBaseVertex)
+#define glDrawElementsInstancedBaseVertex GLEW_GET_FUN(__glewDrawElementsInstancedBaseVertex)
+#define glDrawRangeElementsBaseVertex GLEW_GET_FUN(__glewDrawRangeElementsBaseVertex)
+#define glMultiDrawElementsBaseVertex GLEW_GET_FUN(__glewMultiDrawElementsBaseVertex)
+#define GLEW_ARB_draw_elements_base_vertex GLEW_GET_VAR(__GLEW_ARB_draw_elements_base_vertex)
+#endif /* GL_ARB_draw_elements_base_vertex */
+/* -------------------------- GL_ARB_draw_indirect ------------------------- */
+#ifndef GL_ARB_draw_indirect
+#define GL_ARB_draw_indirect 1
+typedef void (GLAPIENTRY * PFNGLDRAWARRAYSINDIRECTPROC) (GLenum mode, const void *indirect);
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum type, const void *indirect);
+#define glDrawArraysIndirect GLEW_GET_FUN(__glewDrawArraysIndirect)
+#define glDrawElementsIndirect GLEW_GET_FUN(__glewDrawElementsIndirect)
+#define GLEW_ARB_draw_indirect GLEW_GET_VAR(__GLEW_ARB_draw_indirect)
+#endif /* GL_ARB_draw_indirect */
+/* ------------------------- GL_ARB_draw_instanced ------------------------- */
+#ifndef GL_ARB_draw_instanced
+#define GL_ARB_draw_instanced 1
+#define GLEW_ARB_draw_instanced GLEW_GET_VAR(__GLEW_ARB_draw_instanced)
+#endif /* GL_ARB_draw_instanced */
+/* ------------------------ GL_ARB_enhanced_layouts ------------------------ */
+#ifndef GL_ARB_enhanced_layouts
+#define GL_ARB_enhanced_layouts 1
+#define GLEW_ARB_enhanced_layouts GLEW_GET_VAR(__GLEW_ARB_enhanced_layouts)
+#endif /* GL_ARB_enhanced_layouts */
+/* -------------------- GL_ARB_explicit_attrib_location -------------------- */
+#ifndef GL_ARB_explicit_attrib_location
+#define GL_ARB_explicit_attrib_location 1
+#define GLEW_ARB_explicit_attrib_location GLEW_GET_VAR(__GLEW_ARB_explicit_attrib_location)
+#endif /* GL_ARB_explicit_attrib_location */
+/* -------------------- GL_ARB_explicit_uniform_location ------------------- */
+#ifndef GL_ARB_explicit_uniform_location
+#define GL_ARB_explicit_uniform_location 1
+#define GLEW_ARB_explicit_uniform_location GLEW_GET_VAR(__GLEW_ARB_explicit_uniform_location)
+#endif /* GL_ARB_explicit_uniform_location */
+/* ------------------- GL_ARB_fragment_coord_conventions ------------------- */
+#ifndef GL_ARB_fragment_coord_conventions
+#define GL_ARB_fragment_coord_conventions 1
+#define GLEW_ARB_fragment_coord_conventions GLEW_GET_VAR(__GLEW_ARB_fragment_coord_conventions)
+#endif /* GL_ARB_fragment_coord_conventions */
+/* --------------------- GL_ARB_fragment_layer_viewport -------------------- */
+#ifndef GL_ARB_fragment_layer_viewport
+#define GL_ARB_fragment_layer_viewport 1
+#define GLEW_ARB_fragment_layer_viewport GLEW_GET_VAR(__GLEW_ARB_fragment_layer_viewport)
+#endif /* GL_ARB_fragment_layer_viewport */
+/* ------------------------ GL_ARB_fragment_program ------------------------ */
+#ifndef GL_ARB_fragment_program
+#define GL_ARB_fragment_program 1
+#define GLEW_ARB_fragment_program GLEW_GET_VAR(__GLEW_ARB_fragment_program)
+#endif /* GL_ARB_fragment_program */
+/* --------------------- GL_ARB_fragment_program_shadow -------------------- */
+#ifndef GL_ARB_fragment_program_shadow
+#define GL_ARB_fragment_program_shadow 1
+#define GLEW_ARB_fragment_program_shadow GLEW_GET_VAR(__GLEW_ARB_fragment_program_shadow)
+#endif /* GL_ARB_fragment_program_shadow */
+/* ------------------------- GL_ARB_fragment_shader ------------------------ */
+#ifndef GL_ARB_fragment_shader
+#define GL_ARB_fragment_shader 1
+#define GLEW_ARB_fragment_shader GLEW_GET_VAR(__GLEW_ARB_fragment_shader)
+#endif /* GL_ARB_fragment_shader */
+/* -------------------- GL_ARB_fragment_shader_interlock ------------------- */
+#ifndef GL_ARB_fragment_shader_interlock
+#define GL_ARB_fragment_shader_interlock 1
+#define GLEW_ARB_fragment_shader_interlock GLEW_GET_VAR(__GLEW_ARB_fragment_shader_interlock)
+#endif /* GL_ARB_fragment_shader_interlock */
+/* ------------------- GL_ARB_framebuffer_no_attachments ------------------- */
+#ifndef GL_ARB_framebuffer_no_attachments
+#define GL_ARB_framebuffer_no_attachments 1
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERPARAMETERIPROC) (GLenum target, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLGETFRAMEBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDFRAMEBUFFERPARAMETERIVEXTPROC) (GLuint framebuffer, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERPARAMETERIEXTPROC) (GLuint framebuffer, GLenum pname, GLint param);
+#define glFramebufferParameteri GLEW_GET_FUN(__glewFramebufferParameteri)
+#define glGetFramebufferParameteriv GLEW_GET_FUN(__glewGetFramebufferParameteriv)
+#define glGetNamedFramebufferParameterivEXT GLEW_GET_FUN(__glewGetNamedFramebufferParameterivEXT)
+#define glNamedFramebufferParameteriEXT GLEW_GET_FUN(__glewNamedFramebufferParameteriEXT)
+#define GLEW_ARB_framebuffer_no_attachments GLEW_GET_VAR(__GLEW_ARB_framebuffer_no_attachments)
+#endif /* GL_ARB_framebuffer_no_attachments */
+/* ----------------------- GL_ARB_framebuffer_object ----------------------- */
+#ifndef GL_ARB_framebuffer_object
+#define GL_ARB_framebuffer_object 1
+#define GL_INDEX 0x8222
+#define GL_DEPTH_STENCIL 0x84F9
+#define GL_UNSIGNED_INT_24_8 0x84FA
+#define GL_DEPTH24_STENCIL8 0x88F0
+#define GL_SRGB 0x8C40
+#define GL_FRAMEBUFFER 0x8D40
+#define GL_RENDERBUFFER 0x8D41
+#define GL_STENCIL_INDEX1 0x8D46
+#define GL_STENCIL_INDEX4 0x8D47
+#define GL_STENCIL_INDEX8 0x8D48
+#define GL_STENCIL_INDEX16 0x8D49
+#define GL_MAX_SAMPLES 0x8D57
+typedef void (GLAPIENTRY * PFNGLBINDFRAMEBUFFERPROC) (GLenum target, GLuint framebuffer);
+typedef void (GLAPIENTRY * PFNGLBINDRENDERBUFFERPROC) (GLenum target, GLuint renderbuffer);
+typedef void (GLAPIENTRY * PFNGLBLITFRAMEBUFFERPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter);
+typedef void (GLAPIENTRY * PFNGLDELETEFRAMEBUFFERSPROC) (GLsizei n, const GLuint* framebuffers);
+typedef void (GLAPIENTRY * PFNGLDELETERENDERBUFFERSPROC) (GLsizei n, const GLuint* renderbuffers);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERRENDERBUFFERPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURE1DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURE2DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURE3DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint layer);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURELAYERPROC) (GLenum target,GLenum attachment, GLuint texture,GLint level,GLint layer);
+typedef void (GLAPIENTRY * PFNGLGENFRAMEBUFFERSPROC) (GLsizei n, GLuint* framebuffers);
+typedef void (GLAPIENTRY * PFNGLGENRENDERBUFFERSPROC) (GLsizei n, GLuint* renderbuffers);
+typedef void (GLAPIENTRY * PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVPROC) (GLenum target, GLenum attachment, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETRENDERBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISFRAMEBUFFERPROC) (GLuint framebuffer);
+typedef GLboolean (GLAPIENTRY * PFNGLISRENDERBUFFERPROC) (GLuint renderbuffer);
+typedef void (GLAPIENTRY * PFNGLRENDERBUFFERSTORAGEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLRENDERBUFFERSTORAGEMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height);
+#define glBindFramebuffer GLEW_GET_FUN(__glewBindFramebuffer)
+#define glBindRenderbuffer GLEW_GET_FUN(__glewBindRenderbuffer)
+#define glBlitFramebuffer GLEW_GET_FUN(__glewBlitFramebuffer)
+#define glCheckFramebufferStatus GLEW_GET_FUN(__glewCheckFramebufferStatus)
+#define glDeleteFramebuffers GLEW_GET_FUN(__glewDeleteFramebuffers)
+#define glDeleteRenderbuffers GLEW_GET_FUN(__glewDeleteRenderbuffers)
+#define glFramebufferRenderbuffer GLEW_GET_FUN(__glewFramebufferRenderbuffer)
+#define glFramebufferTexture1D GLEW_GET_FUN(__glewFramebufferTexture1D)
+#define glFramebufferTexture2D GLEW_GET_FUN(__glewFramebufferTexture2D)
+#define glFramebufferTexture3D GLEW_GET_FUN(__glewFramebufferTexture3D)
+#define glFramebufferTextureLayer GLEW_GET_FUN(__glewFramebufferTextureLayer)
+#define glGenFramebuffers GLEW_GET_FUN(__glewGenFramebuffers)
+#define glGenRenderbuffers GLEW_GET_FUN(__glewGenRenderbuffers)
+#define glGenerateMipmap GLEW_GET_FUN(__glewGenerateMipmap)
+#define glGetFramebufferAttachmentParameteriv GLEW_GET_FUN(__glewGetFramebufferAttachmentParameteriv)
+#define glGetRenderbufferParameteriv GLEW_GET_FUN(__glewGetRenderbufferParameteriv)
+#define glIsFramebuffer GLEW_GET_FUN(__glewIsFramebuffer)
+#define glIsRenderbuffer GLEW_GET_FUN(__glewIsRenderbuffer)
+#define glRenderbufferStorage GLEW_GET_FUN(__glewRenderbufferStorage)
+#define glRenderbufferStorageMultisample GLEW_GET_FUN(__glewRenderbufferStorageMultisample)
+#define GLEW_ARB_framebuffer_object GLEW_GET_VAR(__GLEW_ARB_framebuffer_object)
+#endif /* GL_ARB_framebuffer_object */
+/* ------------------------ GL_ARB_framebuffer_sRGB ------------------------ */
+#ifndef GL_ARB_framebuffer_sRGB
+#define GL_ARB_framebuffer_sRGB 1
+#define GLEW_ARB_framebuffer_sRGB GLEW_GET_VAR(__GLEW_ARB_framebuffer_sRGB)
+#endif /* GL_ARB_framebuffer_sRGB */
+/* ------------------------ GL_ARB_geometry_shader4 ------------------------ */
+#ifndef GL_ARB_geometry_shader4
+#define GL_ARB_geometry_shader4 1
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTUREARBPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTUREFACEARBPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURELAYERARBPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer);
+typedef void (GLAPIENTRY * PFNGLPROGRAMPARAMETERIARBPROC) (GLuint program, GLenum pname, GLint value);
+#define glFramebufferTextureARB GLEW_GET_FUN(__glewFramebufferTextureARB)
+#define glFramebufferTextureFaceARB GLEW_GET_FUN(__glewFramebufferTextureFaceARB)
+#define glFramebufferTextureLayerARB GLEW_GET_FUN(__glewFramebufferTextureLayerARB)
+#define glProgramParameteriARB GLEW_GET_FUN(__glewProgramParameteriARB)
+#define GLEW_ARB_geometry_shader4 GLEW_GET_VAR(__GLEW_ARB_geometry_shader4)
+#endif /* GL_ARB_geometry_shader4 */
+/* ----------------------- GL_ARB_get_program_binary ----------------------- */
+#ifndef GL_ARB_get_program_binary
+#define GL_ARB_get_program_binary 1
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMBINARYPROC) (GLuint program, GLsizei bufSize, GLsizei* length, GLenum *binaryFormat, void*binary);
+typedef void (GLAPIENTRY * PFNGLPROGRAMBINARYPROC) (GLuint program, GLenum binaryFormat, const void *binary, GLsizei length);
+typedef void (GLAPIENTRY * PFNGLPROGRAMPARAMETERIPROC) (GLuint program, GLenum pname, GLint value);
+#define glGetProgramBinary GLEW_GET_FUN(__glewGetProgramBinary)
+#define glProgramBinary GLEW_GET_FUN(__glewProgramBinary)
+#define glProgramParameteri GLEW_GET_FUN(__glewProgramParameteri)
+#define GLEW_ARB_get_program_binary GLEW_GET_VAR(__GLEW_ARB_get_program_binary)
+#endif /* GL_ARB_get_program_binary */
+/* ---------------------- GL_ARB_get_texture_sub_image --------------------- */
+#ifndef GL_ARB_get_texture_sub_image
+#define GL_ARB_get_texture_sub_image 1
+typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXTURESUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei bufSize, void *pixels);
+typedef void (GLAPIENTRY * PFNGLGETTEXTURESUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, GLsizei bufSize, void *pixels);
+#define glGetCompressedTextureSubImage GLEW_GET_FUN(__glewGetCompressedTextureSubImage)
+#define glGetTextureSubImage GLEW_GET_FUN(__glewGetTextureSubImage)
+#define GLEW_ARB_get_texture_sub_image GLEW_GET_VAR(__GLEW_ARB_get_texture_sub_image)
+#endif /* GL_ARB_get_texture_sub_image */
+/* ---------------------------- GL_ARB_gl_spirv ---------------------------- */
+#ifndef GL_ARB_gl_spirv
+#define GL_ARB_gl_spirv 1
+#define GL_SPIR_V_BINARY_ARB 0x9552
+typedef void (GLAPIENTRY * PFNGLSPECIALIZESHADERARBPROC) (GLuint shader, const GLchar* pEntryPoint, GLuint numSpecializationConstants, const GLuint* pConstantIndex, const GLuint* pConstantValue);
+#define glSpecializeShaderARB GLEW_GET_FUN(__glewSpecializeShaderARB)
+#define GLEW_ARB_gl_spirv GLEW_GET_VAR(__GLEW_ARB_gl_spirv)
+#endif /* GL_ARB_gl_spirv */
+/* --------------------------- GL_ARB_gpu_shader5 -------------------------- */
+#ifndef GL_ARB_gpu_shader5
+#define GL_ARB_gpu_shader5 1
+#define GLEW_ARB_gpu_shader5 GLEW_GET_VAR(__GLEW_ARB_gpu_shader5)
+#endif /* GL_ARB_gpu_shader5 */
+/* ------------------------- GL_ARB_gpu_shader_fp64 ------------------------ */
+#ifndef GL_ARB_gpu_shader_fp64
+#define GL_ARB_gpu_shader_fp64 1
+#define GL_DOUBLE_MAT2 0x8F46
+#define GL_DOUBLE_MAT3 0x8F47
+#define GL_DOUBLE_MAT4 0x8F48
+#define GL_DOUBLE_MAT2x3 0x8F49
+#define GL_DOUBLE_MAT2x4 0x8F4A
+#define GL_DOUBLE_MAT3x2 0x8F4B
+#define GL_DOUBLE_MAT3x4 0x8F4C
+#define GL_DOUBLE_MAT4x2 0x8F4D
+#define GL_DOUBLE_MAT4x3 0x8F4E
+#define GL_DOUBLE_VEC2 0x8FFC
+#define GL_DOUBLE_VEC3 0x8FFD
+#define GL_DOUBLE_VEC4 0x8FFE
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMDVPROC) (GLuint program, GLint location, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1DPROC) (GLint location, GLdouble x);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1DVPROC) (GLint location, GLsizei count, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2DPROC) (GLint location, GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2DVPROC) (GLint location, GLsizei count, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3DPROC) (GLint location, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3DVPROC) (GLint location, GLsizei count, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4DPROC) (GLint location, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4DVPROC) (GLint location, GLsizei count, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2X3DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2X4DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3X2DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3X4DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4X2DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4X3DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+#define glGetUniformdv GLEW_GET_FUN(__glewGetUniformdv)
+#define glUniform1d GLEW_GET_FUN(__glewUniform1d)
+#define glUniform1dv GLEW_GET_FUN(__glewUniform1dv)
+#define glUniform2d GLEW_GET_FUN(__glewUniform2d)
+#define glUniform2dv GLEW_GET_FUN(__glewUniform2dv)
+#define glUniform3d GLEW_GET_FUN(__glewUniform3d)
+#define glUniform3dv GLEW_GET_FUN(__glewUniform3dv)
+#define glUniform4d GLEW_GET_FUN(__glewUniform4d)
+#define glUniform4dv GLEW_GET_FUN(__glewUniform4dv)
+#define glUniformMatrix2dv GLEW_GET_FUN(__glewUniformMatrix2dv)
+#define glUniformMatrix2x3dv GLEW_GET_FUN(__glewUniformMatrix2x3dv)
+#define glUniformMatrix2x4dv GLEW_GET_FUN(__glewUniformMatrix2x4dv)
+#define glUniformMatrix3dv GLEW_GET_FUN(__glewUniformMatrix3dv)
+#define glUniformMatrix3x2dv GLEW_GET_FUN(__glewUniformMatrix3x2dv)
+#define glUniformMatrix3x4dv GLEW_GET_FUN(__glewUniformMatrix3x4dv)
+#define glUniformMatrix4dv GLEW_GET_FUN(__glewUniformMatrix4dv)
+#define glUniformMatrix4x2dv GLEW_GET_FUN(__glewUniformMatrix4x2dv)
+#define glUniformMatrix4x3dv GLEW_GET_FUN(__glewUniformMatrix4x3dv)
+#define GLEW_ARB_gpu_shader_fp64 GLEW_GET_VAR(__GLEW_ARB_gpu_shader_fp64)
+#endif /* GL_ARB_gpu_shader_fp64 */
+/* ------------------------ GL_ARB_gpu_shader_int64 ------------------------ */
+#ifndef GL_ARB_gpu_shader_int64
+#define GL_ARB_gpu_shader_int64 1
+#define GL_INT64_ARB 0x140E
+#define GL_UNSIGNED_INT64_ARB 0x140F
+#define GL_INT64_VEC2_ARB 0x8FE9
+#define GL_INT64_VEC3_ARB 0x8FEA
+#define GL_INT64_VEC4_ARB 0x8FEB
+#define GL_UNSIGNED_INT64_VEC2_ARB 0x8FF5
+#define GL_UNSIGNED_INT64_VEC3_ARB 0x8FF6
+#define GL_UNSIGNED_INT64_VEC4_ARB 0x8FF7
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMI64VARBPROC) (GLuint program, GLint location, GLint64* params);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMUI64VARBPROC) (GLuint program, GLint location, GLuint64* params);
+typedef void (GLAPIENTRY * PFNGLGETNUNIFORMI64VARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLint64* params);
+typedef void (GLAPIENTRY * PFNGLGETNUNIFORMUI64VARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint64* params);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1I64ARBPROC) (GLuint program, GLint location, GLint64 x);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1UI64ARBPROC) (GLuint program, GLint location, GLuint64 x);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1I64ARBPROC) (GLint location, GLint64 x);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1I64VARBPROC) (GLint location, GLsizei count, const GLint64* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1UI64ARBPROC) (GLint location, GLuint64 x);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1UI64VARBPROC) (GLint location, GLsizei count, const GLuint64* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2I64ARBPROC) (GLint location, GLint64 x, GLint64 y);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2I64VARBPROC) (GLint location, GLsizei count, const GLint64* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2UI64VARBPROC) (GLint location, GLsizei count, const GLuint64* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3I64ARBPROC) (GLint location, GLint64 x, GLint64 y, GLint64 z);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3I64VARBPROC) (GLint location, GLsizei count, const GLint64* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y, GLuint64 z);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3UI64VARBPROC) (GLint location, GLsizei count, const GLuint64* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4I64ARBPROC) (GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4I64VARBPROC) (GLint location, GLsizei count, const GLint64* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4UI64VARBPROC) (GLint location, GLsizei count, const GLuint64* value);
+#define glGetUniformi64vARB GLEW_GET_FUN(__glewGetUniformi64vARB)
+#define glGetUniformui64vARB GLEW_GET_FUN(__glewGetUniformui64vARB)
+#define glGetnUniformi64vARB GLEW_GET_FUN(__glewGetnUniformi64vARB)
+#define glGetnUniformui64vARB GLEW_GET_FUN(__glewGetnUniformui64vARB)
+#define glProgramUniform1i64ARB GLEW_GET_FUN(__glewProgramUniform1i64ARB)
+#define glProgramUniform1i64vARB GLEW_GET_FUN(__glewProgramUniform1i64vARB)
+#define glProgramUniform1ui64ARB GLEW_GET_FUN(__glewProgramUniform1ui64ARB)
+#define glProgramUniform1ui64vARB GLEW_GET_FUN(__glewProgramUniform1ui64vARB)
+#define glProgramUniform2i64ARB GLEW_GET_FUN(__glewProgramUniform2i64ARB)
+#define glProgramUniform2i64vARB GLEW_GET_FUN(__glewProgramUniform2i64vARB)
+#define glProgramUniform2ui64ARB GLEW_GET_FUN(__glewProgramUniform2ui64ARB)
+#define glProgramUniform2ui64vARB GLEW_GET_FUN(__glewProgramUniform2ui64vARB)
+#define glProgramUniform3i64ARB GLEW_GET_FUN(__glewProgramUniform3i64ARB)
+#define glProgramUniform3i64vARB GLEW_GET_FUN(__glewProgramUniform3i64vARB)
+#define glProgramUniform3ui64ARB GLEW_GET_FUN(__glewProgramUniform3ui64ARB)
+#define glProgramUniform3ui64vARB GLEW_GET_FUN(__glewProgramUniform3ui64vARB)
+#define glProgramUniform4i64ARB GLEW_GET_FUN(__glewProgramUniform4i64ARB)
+#define glProgramUniform4i64vARB GLEW_GET_FUN(__glewProgramUniform4i64vARB)
+#define glProgramUniform4ui64ARB GLEW_GET_FUN(__glewProgramUniform4ui64ARB)
+#define glProgramUniform4ui64vARB GLEW_GET_FUN(__glewProgramUniform4ui64vARB)
+#define glUniform1i64ARB GLEW_GET_FUN(__glewUniform1i64ARB)
+#define glUniform1i64vARB GLEW_GET_FUN(__glewUniform1i64vARB)
+#define glUniform1ui64ARB GLEW_GET_FUN(__glewUniform1ui64ARB)
+#define glUniform1ui64vARB GLEW_GET_FUN(__glewUniform1ui64vARB)
+#define glUniform2i64ARB GLEW_GET_FUN(__glewUniform2i64ARB)
+#define glUniform2i64vARB GLEW_GET_FUN(__glewUniform2i64vARB)
+#define glUniform2ui64ARB GLEW_GET_FUN(__glewUniform2ui64ARB)
+#define glUniform2ui64vARB GLEW_GET_FUN(__glewUniform2ui64vARB)
+#define glUniform3i64ARB GLEW_GET_FUN(__glewUniform3i64ARB)
+#define glUniform3i64vARB GLEW_GET_FUN(__glewUniform3i64vARB)
+#define glUniform3ui64ARB GLEW_GET_FUN(__glewUniform3ui64ARB)
+#define glUniform3ui64vARB GLEW_GET_FUN(__glewUniform3ui64vARB)
+#define glUniform4i64ARB GLEW_GET_FUN(__glewUniform4i64ARB)
+#define glUniform4i64vARB GLEW_GET_FUN(__glewUniform4i64vARB)
+#define glUniform4ui64ARB GLEW_GET_FUN(__glewUniform4ui64ARB)
+#define glUniform4ui64vARB GLEW_GET_FUN(__glewUniform4ui64vARB)
+#define GLEW_ARB_gpu_shader_int64 GLEW_GET_VAR(__GLEW_ARB_gpu_shader_int64)
+#endif /* GL_ARB_gpu_shader_int64 */
+/* ------------------------ GL_ARB_half_float_pixel ------------------------ */
+#ifndef GL_ARB_half_float_pixel
+#define GL_ARB_half_float_pixel 1
+#define GL_HALF_FLOAT_ARB 0x140B
+#define GLEW_ARB_half_float_pixel GLEW_GET_VAR(__GLEW_ARB_half_float_pixel)
+#endif /* GL_ARB_half_float_pixel */
+/* ------------------------ GL_ARB_half_float_vertex ----------------------- */
+#ifndef GL_ARB_half_float_vertex
+#define GL_ARB_half_float_vertex 1
+#define GL_HALF_FLOAT 0x140B
+#define GLEW_ARB_half_float_vertex GLEW_GET_VAR(__GLEW_ARB_half_float_vertex)
+#endif /* GL_ARB_half_float_vertex */
+/* ----------------------------- GL_ARB_imaging ---------------------------- */
+#ifndef GL_ARB_imaging
+#define GL_ARB_imaging 1
+#define GL_CONSTANT_COLOR 0x8001
+#define GL_CONSTANT_ALPHA 0x8003
+#define GL_BLEND_COLOR 0x8005
+#define GL_FUNC_ADD 0x8006
+#define GL_MIN 0x8007
+#define GL_MAX 0x8008
+#define GL_BLEND_EQUATION 0x8009
+#define GL_FUNC_SUBTRACT 0x800A
+#define GL_CONVOLUTION_1D 0x8010
+#define GL_CONVOLUTION_2D 0x8011
+#define GL_SEPARABLE_2D 0x8012
+#define GL_REDUCE 0x8016
+#define GL_CONVOLUTION_WIDTH 0x8018
+#define GL_HISTOGRAM 0x8024
+#define GL_PROXY_HISTOGRAM 0x8025
+#define GL_HISTOGRAM_WIDTH 0x8026
+#define GL_HISTOGRAM_FORMAT 0x8027
+#define GL_HISTOGRAM_RED_SIZE 0x8028
+#define GL_HISTOGRAM_SINK 0x802D
+#define GL_MINMAX 0x802E
+#define GL_MINMAX_FORMAT 0x802F
+#define GL_MINMAX_SINK 0x8030
+#define GL_TABLE_TOO_LARGE 0x8031
+#define GL_COLOR_MATRIX 0x80B1
+#define GL_COLOR_TABLE 0x80D0
+#define GL_PROXY_COLOR_TABLE 0x80D3
+#define GL_COLOR_TABLE_SCALE 0x80D6
+#define GL_COLOR_TABLE_BIAS 0x80D7
+#define GL_COLOR_TABLE_WIDTH 0x80D9
+#define GL_IGNORE_BORDER 0x8150
+#define GL_CONSTANT_BORDER 0x8151
+#define GL_WRAP_BORDER 0x8152
+#define GL_REPLICATE_BORDER 0x8153
+typedef void (GLAPIENTRY * PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *table);
+typedef void (GLAPIENTRY * PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *image);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *image);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (GLAPIENTRY * PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, void *table);
+typedef void (GLAPIENTRY * PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (GLAPIENTRY * PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, void *image);
+typedef void (GLAPIENTRY * PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (GLAPIENTRY * PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values);
+typedef void (GLAPIENTRY * PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (GLAPIENTRY * PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum types, void *values);
+typedef void (GLAPIENTRY * PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (GLAPIENTRY * PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, void *row, void *column, void *span);
+typedef void (GLAPIENTRY * PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink);
+typedef void (GLAPIENTRY * PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, GLboolean sink);
+typedef void (GLAPIENTRY * PFNGLRESETMINMAXPROC) (GLenum target);
+typedef void (GLAPIENTRY * PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *row, const void *column);
+#define glColorSubTable GLEW_GET_FUN(__glewColorSubTable)
+#define glColorTable GLEW_GET_FUN(__glewColorTable)
+#define glColorTableParameterfv GLEW_GET_FUN(__glewColorTableParameterfv)
+#define glColorTableParameteriv GLEW_GET_FUN(__glewColorTableParameteriv)
+#define glConvolutionFilter1D GLEW_GET_FUN(__glewConvolutionFilter1D)
+#define glConvolutionFilter2D GLEW_GET_FUN(__glewConvolutionFilter2D)
+#define glConvolutionParameterf GLEW_GET_FUN(__glewConvolutionParameterf)
+#define glConvolutionParameterfv GLEW_GET_FUN(__glewConvolutionParameterfv)
+#define glConvolutionParameteri GLEW_GET_FUN(__glewConvolutionParameteri)
+#define glConvolutionParameteriv GLEW_GET_FUN(__glewConvolutionParameteriv)
+#define glCopyColorSubTable GLEW_GET_FUN(__glewCopyColorSubTable)
+#define glCopyColorTable GLEW_GET_FUN(__glewCopyColorTable)
+#define glCopyConvolutionFilter1D GLEW_GET_FUN(__glewCopyConvolutionFilter1D)
+#define glCopyConvolutionFilter2D GLEW_GET_FUN(__glewCopyConvolutionFilter2D)
+#define glGetColorTable GLEW_GET_FUN(__glewGetColorTable)
+#define glGetColorTableParameterfv GLEW_GET_FUN(__glewGetColorTableParameterfv)
+#define glGetColorTableParameteriv GLEW_GET_FUN(__glewGetColorTableParameteriv)
+#define glGetConvolutionFilter GLEW_GET_FUN(__glewGetConvolutionFilter)
+#define glGetConvolutionParameterfv GLEW_GET_FUN(__glewGetConvolutionParameterfv)
+#define glGetConvolutionParameteriv GLEW_GET_FUN(__glewGetConvolutionParameteriv)
+#define glGetHistogram GLEW_GET_FUN(__glewGetHistogram)
+#define glGetHistogramParameterfv GLEW_GET_FUN(__glewGetHistogramParameterfv)
+#define glGetHistogramParameteriv GLEW_GET_FUN(__glewGetHistogramParameteriv)
+#define glGetMinmax GLEW_GET_FUN(__glewGetMinmax)
+#define glGetMinmaxParameterfv GLEW_GET_FUN(__glewGetMinmaxParameterfv)
+#define glGetMinmaxParameteriv GLEW_GET_FUN(__glewGetMinmaxParameteriv)
+#define glGetSeparableFilter GLEW_GET_FUN(__glewGetSeparableFilter)
+#define glHistogram GLEW_GET_FUN(__glewHistogram)
+#define glMinmax GLEW_GET_FUN(__glewMinmax)
+#define glResetHistogram GLEW_GET_FUN(__glewResetHistogram)
+#define glResetMinmax GLEW_GET_FUN(__glewResetMinmax)
+#define glSeparableFilter2D GLEW_GET_FUN(__glewSeparableFilter2D)
+#define GLEW_ARB_imaging GLEW_GET_VAR(__GLEW_ARB_imaging)
+#endif /* GL_ARB_imaging */
+/* ----------------------- GL_ARB_indirect_parameters ---------------------- */
+#ifndef GL_ARB_indirect_parameters
+#define GL_ARB_indirect_parameters 1
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWARRAYSINDIRECTCOUNTARBPROC) (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTARBPROC) (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride);
+#define glMultiDrawArraysIndirectCountARB GLEW_GET_FUN(__glewMultiDrawArraysIndirectCountARB)
+#define glMultiDrawElementsIndirectCountARB GLEW_GET_FUN(__glewMultiDrawElementsIndirectCountARB)
+#define GLEW_ARB_indirect_parameters GLEW_GET_VAR(__GLEW_ARB_indirect_parameters)
+#endif /* GL_ARB_indirect_parameters */
+/* ------------------------ GL_ARB_instanced_arrays ------------------------ */
+#ifndef GL_ARB_instanced_arrays
+#define GL_ARB_instanced_arrays 1
+typedef void (GLAPIENTRY * PFNGLDRAWARRAYSINSTANCEDARBPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDARBPROC) (GLenum mode, GLsizei count, GLenum type, const void* indices, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBDIVISORARBPROC) (GLuint index, GLuint divisor);
+#define glDrawArraysInstancedARB GLEW_GET_FUN(__glewDrawArraysInstancedARB)
+#define glDrawElementsInstancedARB GLEW_GET_FUN(__glewDrawElementsInstancedARB)
+#define glVertexAttribDivisorARB GLEW_GET_FUN(__glewVertexAttribDivisorARB)
+#define GLEW_ARB_instanced_arrays GLEW_GET_VAR(__GLEW_ARB_instanced_arrays)
+#endif /* GL_ARB_instanced_arrays */
+/* ---------------------- GL_ARB_internalformat_query ---------------------- */
+#ifndef GL_ARB_internalformat_query
+#define GL_ARB_internalformat_query 1
+#define GL_NUM_SAMPLE_COUNTS 0x9380
+typedef void (GLAPIENTRY * PFNGLGETINTERNALFORMATIVPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint* params);
+#define glGetInternalformativ GLEW_GET_FUN(__glewGetInternalformativ)
+#define GLEW_ARB_internalformat_query GLEW_GET_VAR(__GLEW_ARB_internalformat_query)
+#endif /* GL_ARB_internalformat_query */
+/* ---------------------- GL_ARB_internalformat_query2 --------------------- */
+#ifndef GL_ARB_internalformat_query2
+#define GL_ARB_internalformat_query2 1
+#define GL_MAX_WIDTH 0x827E
+#define GL_MAX_HEIGHT 0x827F
+#define GL_MAX_DEPTH 0x8280
+#define GL_MAX_LAYERS 0x8281
+#define GL_COLOR_COMPONENTS 0x8283
+#define GL_DEPTH_COMPONENTS 0x8284
+#define GL_COLOR_RENDERABLE 0x8286
+#define GL_DEPTH_RENDERABLE 0x8287
+#define GL_READ_PIXELS 0x828C
+#define GL_READ_PIXELS_TYPE 0x828E
+#define GL_TEXTURE_IMAGE_TYPE 0x8290
+#define GL_MIPMAP 0x8293
+#define GL_COLOR_ENCODING 0x8296
+#define GL_SRGB_READ 0x8297
+#define GL_SRGB_WRITE 0x8298
+#define GL_SRGB_DECODE_ARB 0x8299
+#define GL_FILTER 0x829A
+#define GL_VERTEX_TEXTURE 0x829B
+#define GL_COMPUTE_TEXTURE 0x82A0
+#define GL_TEXTURE_SHADOW 0x82A1
+#define GL_TEXTURE_GATHER 0x82A2
+#define GL_SHADER_IMAGE_LOAD 0x82A4
+#define GL_IMAGE_TEXEL_SIZE 0x82A7
+#define GL_CLEAR_BUFFER 0x82B4
+#define GL_TEXTURE_VIEW 0x82B5
+#define GL_FULL_SUPPORT 0x82B7
+#define GL_CAVEAT_SUPPORT 0x82B8
+#define GL_IMAGE_CLASS_4_X_32 0x82B9
+#define GL_IMAGE_CLASS_2_X_32 0x82BA
+#define GL_IMAGE_CLASS_1_X_32 0x82BB
+#define GL_IMAGE_CLASS_4_X_16 0x82BC
+#define GL_IMAGE_CLASS_2_X_16 0x82BD
+#define GL_IMAGE_CLASS_1_X_16 0x82BE
+#define GL_IMAGE_CLASS_4_X_8 0x82BF
+#define GL_IMAGE_CLASS_2_X_8 0x82C0
+#define GL_IMAGE_CLASS_1_X_8 0x82C1
+#define GL_IMAGE_CLASS_11_11_10 0x82C2
+#define GL_IMAGE_CLASS_10_10_10_2 0x82C3
+#define GL_VIEW_CLASS_128_BITS 0x82C4
+#define GL_VIEW_CLASS_96_BITS 0x82C5
+#define GL_VIEW_CLASS_64_BITS 0x82C6
+#define GL_VIEW_CLASS_48_BITS 0x82C7
+#define GL_VIEW_CLASS_32_BITS 0x82C8
+#define GL_VIEW_CLASS_24_BITS 0x82C9
+#define GL_VIEW_CLASS_16_BITS 0x82CA
+#define GL_VIEW_CLASS_8_BITS 0x82CB
+#define GL_VIEW_CLASS_RGTC1_RED 0x82D0
+#define GL_VIEW_CLASS_RGTC2_RG 0x82D1
+typedef void (GLAPIENTRY * PFNGLGETINTERNALFORMATI64VPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64* params);
+#define glGetInternalformati64v GLEW_GET_FUN(__glewGetInternalformati64v)
+#define GLEW_ARB_internalformat_query2 GLEW_GET_VAR(__GLEW_ARB_internalformat_query2)
+#endif /* GL_ARB_internalformat_query2 */
+/* ----------------------- GL_ARB_invalidate_subdata ----------------------- */
+#ifndef GL_ARB_invalidate_subdata
+#define GL_ARB_invalidate_subdata 1
+typedef void (GLAPIENTRY * PFNGLINVALIDATEBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length);
+typedef void (GLAPIENTRY * PFNGLINVALIDATEFRAMEBUFFERPROC) (GLenum target, GLsizei numAttachments, const GLenum* attachments);
+typedef void (GLAPIENTRY * PFNGLINVALIDATESUBFRAMEBUFFERPROC) (GLenum target, GLsizei numAttachments, const GLenum* attachments, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLINVALIDATETEXIMAGEPROC) (GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLINVALIDATETEXSUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth);
+#define glInvalidateBufferData GLEW_GET_FUN(__glewInvalidateBufferData)
+#define glInvalidateBufferSubData GLEW_GET_FUN(__glewInvalidateBufferSubData)
+#define glInvalidateFramebuffer GLEW_GET_FUN(__glewInvalidateFramebuffer)
+#define glInvalidateSubFramebuffer GLEW_GET_FUN(__glewInvalidateSubFramebuffer)
+#define glInvalidateTexImage GLEW_GET_FUN(__glewInvalidateTexImage)
+#define glInvalidateTexSubImage GLEW_GET_FUN(__glewInvalidateTexSubImage)
+#define GLEW_ARB_invalidate_subdata GLEW_GET_VAR(__GLEW_ARB_invalidate_subdata)
+#endif /* GL_ARB_invalidate_subdata */
+/* ---------------------- GL_ARB_map_buffer_alignment ---------------------- */
+#ifndef GL_ARB_map_buffer_alignment
+#define GL_ARB_map_buffer_alignment 1
+#define GLEW_ARB_map_buffer_alignment GLEW_GET_VAR(__GLEW_ARB_map_buffer_alignment)
+#endif /* GL_ARB_map_buffer_alignment */
+/* ------------------------ GL_ARB_map_buffer_range ------------------------ */
+#ifndef GL_ARB_map_buffer_range
+#define GL_ARB_map_buffer_range 1
+#define GL_MAP_READ_BIT 0x0001
+#define GL_MAP_WRITE_BIT 0x0002
+typedef void (GLAPIENTRY * PFNGLFLUSHMAPPEDBUFFERRANGEPROC) (GLenum target, GLintptr offset, GLsizeiptr length);
+typedef void * (GLAPIENTRY * PFNGLMAPBUFFERRANGEPROC) (GLenum target, GLintptr offset, GLsizeiptr length, GLbitfield access);
+#define glFlushMappedBufferRange GLEW_GET_FUN(__glewFlushMappedBufferRange)
+#define glMapBufferRange GLEW_GET_FUN(__glewMapBufferRange)
+#define GLEW_ARB_map_buffer_range GLEW_GET_VAR(__GLEW_ARB_map_buffer_range)
+#endif /* GL_ARB_map_buffer_range */
+/* ------------------------- GL_ARB_matrix_palette ------------------------- */
+#ifndef GL_ARB_matrix_palette
+#define GL_ARB_matrix_palette 1
+#define GL_MATRIX_PALETTE_ARB 0x8840
+typedef void (GLAPIENTRY * PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, void *pointer);
+typedef void (GLAPIENTRY * PFNGLMATRIXINDEXUBVARBPROC) (GLint size, GLubyte *indices);
+typedef void (GLAPIENTRY * PFNGLMATRIXINDEXUIVARBPROC) (GLint size, GLuint *indices);
+typedef void (GLAPIENTRY * PFNGLMATRIXINDEXUSVARBPROC) (GLint size, GLushort *indices);
+#define glCurrentPaletteMatrixARB GLEW_GET_FUN(__glewCurrentPaletteMatrixARB)
+#define glMatrixIndexPointerARB GLEW_GET_FUN(__glewMatrixIndexPointerARB)
+#define glMatrixIndexubvARB GLEW_GET_FUN(__glewMatrixIndexubvARB)
+#define glMatrixIndexuivARB GLEW_GET_FUN(__glewMatrixIndexuivARB)
+#define glMatrixIndexusvARB GLEW_GET_FUN(__glewMatrixIndexusvARB)
+#define GLEW_ARB_matrix_palette GLEW_GET_VAR(__GLEW_ARB_matrix_palette)
+#endif /* GL_ARB_matrix_palette */
+/* --------------------------- GL_ARB_multi_bind --------------------------- */
+#ifndef GL_ARB_multi_bind
+#define GL_ARB_multi_bind 1
+typedef void (GLAPIENTRY * PFNGLBINDBUFFERSBASEPROC) (GLenum target, GLuint first, GLsizei count, const GLuint* buffers);
+typedef void (GLAPIENTRY * PFNGLBINDBUFFERSRANGEPROC) (GLenum target, GLuint first, GLsizei count, const GLuint* buffers, const GLintptr *offsets, const GLsizeiptr *sizes);
+typedef void (GLAPIENTRY * PFNGLBINDIMAGETEXTURESPROC) (GLuint first, GLsizei count, const GLuint* textures);
+typedef void (GLAPIENTRY * PFNGLBINDSAMPLERSPROC) (GLuint first, GLsizei count, const GLuint* samplers);
+typedef void (GLAPIENTRY * PFNGLBINDTEXTURESPROC) (GLuint first, GLsizei count, const GLuint* textures);
+typedef void (GLAPIENTRY * PFNGLBINDVERTEXBUFFERSPROC) (GLuint first, GLsizei count, const GLuint* buffers, const GLintptr *offsets, const GLsizei *strides);
+#define glBindBuffersBase GLEW_GET_FUN(__glewBindBuffersBase)
+#define glBindBuffersRange GLEW_GET_FUN(__glewBindBuffersRange)
+#define glBindImageTextures GLEW_GET_FUN(__glewBindImageTextures)
+#define glBindSamplers GLEW_GET_FUN(__glewBindSamplers)
+#define glBindTextures GLEW_GET_FUN(__glewBindTextures)
+#define glBindVertexBuffers GLEW_GET_FUN(__glewBindVertexBuffers)
+#define GLEW_ARB_multi_bind GLEW_GET_VAR(__GLEW_ARB_multi_bind)
+#endif /* GL_ARB_multi_bind */
+/* ----------------------- GL_ARB_multi_draw_indirect ---------------------- */
+#ifndef GL_ARB_multi_draw_indirect
+#define GL_ARB_multi_draw_indirect 1
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWARRAYSINDIRECTPROC) (GLenum mode, const void *indirect, GLsizei primcount, GLsizei stride);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei primcount, GLsizei stride);
+#define glMultiDrawArraysIndirect GLEW_GET_FUN(__glewMultiDrawArraysIndirect)
+#define glMultiDrawElementsIndirect GLEW_GET_FUN(__glewMultiDrawElementsIndirect)
+#define GLEW_ARB_multi_draw_indirect GLEW_GET_VAR(__GLEW_ARB_multi_draw_indirect)
+#endif /* GL_ARB_multi_draw_indirect */
+/* --------------------------- GL_ARB_multisample -------------------------- */
+#ifndef GL_ARB_multisample
+#define GL_ARB_multisample 1
+#define GL_MULTISAMPLE_ARB 0x809D
+#define GL_SAMPLES_ARB 0x80A9
+#define GL_MULTISAMPLE_BIT_ARB 0x20000000
+typedef void (GLAPIENTRY * PFNGLSAMPLECOVERAGEARBPROC) (GLclampf value, GLboolean invert);
+#define glSampleCoverageARB GLEW_GET_FUN(__glewSampleCoverageARB)
+#define GLEW_ARB_multisample GLEW_GET_VAR(__GLEW_ARB_multisample)
+#endif /* GL_ARB_multisample */
+/* -------------------------- GL_ARB_multitexture -------------------------- */
+#ifndef GL_ARB_multitexture
+#define GL_ARB_multitexture 1
+#define GL_TEXTURE0_ARB 0x84C0
+#define GL_TEXTURE1_ARB 0x84C1
+#define GL_TEXTURE2_ARB 0x84C2
+#define GL_TEXTURE3_ARB 0x84C3
+#define GL_TEXTURE4_ARB 0x84C4
+#define GL_TEXTURE5_ARB 0x84C5
+#define GL_TEXTURE6_ARB 0x84C6
+#define GL_TEXTURE7_ARB 0x84C7
+#define GL_TEXTURE8_ARB 0x84C8
+#define GL_TEXTURE9_ARB 0x84C9
+#define GL_TEXTURE10_ARB 0x84CA
+#define GL_TEXTURE11_ARB 0x84CB
+#define GL_TEXTURE12_ARB 0x84CC
+#define GL_TEXTURE13_ARB 0x84CD
+#define GL_TEXTURE14_ARB 0x84CE
+#define GL_TEXTURE15_ARB 0x84CF
+#define GL_TEXTURE16_ARB 0x84D0
+#define GL_TEXTURE17_ARB 0x84D1
+#define GL_TEXTURE18_ARB 0x84D2
+#define GL_TEXTURE19_ARB 0x84D3
+#define GL_TEXTURE20_ARB 0x84D4
+#define GL_TEXTURE21_ARB 0x84D5
+#define GL_TEXTURE22_ARB 0x84D6
+#define GL_TEXTURE23_ARB 0x84D7
+#define GL_TEXTURE24_ARB 0x84D8
+#define GL_TEXTURE25_ARB 0x84D9
+#define GL_TEXTURE26_ARB 0x84DA
+#define GL_TEXTURE27_ARB 0x84DB
+#define GL_TEXTURE28_ARB 0x84DC
+#define GL_TEXTURE29_ARB 0x84DD
+#define GL_TEXTURE30_ARB 0x84DE
+#define GL_TEXTURE31_ARB 0x84DF
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1DARBPROC) (GLenum target, GLdouble s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1FARBPROC) (GLenum target, GLfloat s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1IARBPROC) (GLenum target, GLint s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1IVARBPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1SARBPROC) (GLenum target, GLshort s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2DARBPROC) (GLenum target, GLdouble s, GLdouble t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2FARBPROC) (GLenum target, GLfloat s, GLfloat t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2IARBPROC) (GLenum target, GLint s, GLint t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2IVARBPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2SARBPROC) (GLenum target, GLshort s, GLshort t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3IARBPROC) (GLenum target, GLint s, GLint t, GLint r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3IVARBPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4IARBPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4IVARBPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4SVARBPROC) (GLenum target, const GLshort *v);
+#define glActiveTextureARB GLEW_GET_FUN(__glewActiveTextureARB)
+#define glClientActiveTextureARB GLEW_GET_FUN(__glewClientActiveTextureARB)
+#define glMultiTexCoord1dARB GLEW_GET_FUN(__glewMultiTexCoord1dARB)
+#define glMultiTexCoord1dvARB GLEW_GET_FUN(__glewMultiTexCoord1dvARB)
+#define glMultiTexCoord1fARB GLEW_GET_FUN(__glewMultiTexCoord1fARB)
+#define glMultiTexCoord1fvARB GLEW_GET_FUN(__glewMultiTexCoord1fvARB)
+#define glMultiTexCoord1iARB GLEW_GET_FUN(__glewMultiTexCoord1iARB)
+#define glMultiTexCoord1ivARB GLEW_GET_FUN(__glewMultiTexCoord1ivARB)
+#define glMultiTexCoord1sARB GLEW_GET_FUN(__glewMultiTexCoord1sARB)
+#define glMultiTexCoord1svARB GLEW_GET_FUN(__glewMultiTexCoord1svARB)
+#define glMultiTexCoord2dARB GLEW_GET_FUN(__glewMultiTexCoord2dARB)
+#define glMultiTexCoord2dvARB GLEW_GET_FUN(__glewMultiTexCoord2dvARB)
+#define glMultiTexCoord2fARB GLEW_GET_FUN(__glewMultiTexCoord2fARB)
+#define glMultiTexCoord2fvARB GLEW_GET_FUN(__glewMultiTexCoord2fvARB)
+#define glMultiTexCoord2iARB GLEW_GET_FUN(__glewMultiTexCoord2iARB)
+#define glMultiTexCoord2ivARB GLEW_GET_FUN(__glewMultiTexCoord2ivARB)
+#define glMultiTexCoord2sARB GLEW_GET_FUN(__glewMultiTexCoord2sARB)
+#define glMultiTexCoord2svARB GLEW_GET_FUN(__glewMultiTexCoord2svARB)
+#define glMultiTexCoord3dARB GLEW_GET_FUN(__glewMultiTexCoord3dARB)
+#define glMultiTexCoord3dvARB GLEW_GET_FUN(__glewMultiTexCoord3dvARB)
+#define glMultiTexCoord3fARB GLEW_GET_FUN(__glewMultiTexCoord3fARB)
+#define glMultiTexCoord3fvARB GLEW_GET_FUN(__glewMultiTexCoord3fvARB)
+#define glMultiTexCoord3iARB GLEW_GET_FUN(__glewMultiTexCoord3iARB)
+#define glMultiTexCoord3ivARB GLEW_GET_FUN(__glewMultiTexCoord3ivARB)
+#define glMultiTexCoord3sARB GLEW_GET_FUN(__glewMultiTexCoord3sARB)
+#define glMultiTexCoord3svARB GLEW_GET_FUN(__glewMultiTexCoord3svARB)
+#define glMultiTexCoord4dARB GLEW_GET_FUN(__glewMultiTexCoord4dARB)
+#define glMultiTexCoord4dvARB GLEW_GET_FUN(__glewMultiTexCoord4dvARB)
+#define glMultiTexCoord4fARB GLEW_GET_FUN(__glewMultiTexCoord4fARB)
+#define glMultiTexCoord4fvARB GLEW_GET_FUN(__glewMultiTexCoord4fvARB)
+#define glMultiTexCoord4iARB GLEW_GET_FUN(__glewMultiTexCoord4iARB)
+#define glMultiTexCoord4ivARB GLEW_GET_FUN(__glewMultiTexCoord4ivARB)
+#define glMultiTexCoord4sARB GLEW_GET_FUN(__glewMultiTexCoord4sARB)
+#define glMultiTexCoord4svARB GLEW_GET_FUN(__glewMultiTexCoord4svARB)
+#define GLEW_ARB_multitexture GLEW_GET_VAR(__GLEW_ARB_multitexture)
+#endif /* GL_ARB_multitexture */
+/* ------------------------- GL_ARB_occlusion_query ------------------------ */
+#ifndef GL_ARB_occlusion_query
+#define GL_ARB_occlusion_query 1
+#define GL_CURRENT_QUERY_ARB 0x8865
+#define GL_QUERY_RESULT_ARB 0x8866
+#define GL_SAMPLES_PASSED_ARB 0x8914
+typedef void (GLAPIENTRY * PFNGLBEGINQUERYARBPROC) (GLenum target, GLuint id);
+typedef void (GLAPIENTRY * PFNGLDELETEQUERIESARBPROC) (GLsizei n, const GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLENDQUERYARBPROC) (GLenum target);
+typedef void (GLAPIENTRY * PFNGLGENQUERIESARBPROC) (GLsizei n, GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTIVARBPROC) (GLuint id, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTUIVARBPROC) (GLuint id, GLenum pname, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYIVARBPROC) (GLenum target, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISQUERYARBPROC) (GLuint id);
+#define glBeginQueryARB GLEW_GET_FUN(__glewBeginQueryARB)
+#define glDeleteQueriesARB GLEW_GET_FUN(__glewDeleteQueriesARB)
+#define glEndQueryARB GLEW_GET_FUN(__glewEndQueryARB)
+#define glGenQueriesARB GLEW_GET_FUN(__glewGenQueriesARB)
+#define glGetQueryObjectivARB GLEW_GET_FUN(__glewGetQueryObjectivARB)
+#define glGetQueryObjectuivARB GLEW_GET_FUN(__glewGetQueryObjectuivARB)
+#define glGetQueryivARB GLEW_GET_FUN(__glewGetQueryivARB)
+#define glIsQueryARB GLEW_GET_FUN(__glewIsQueryARB)
+#define GLEW_ARB_occlusion_query GLEW_GET_VAR(__GLEW_ARB_occlusion_query)
+#endif /* GL_ARB_occlusion_query */
+/* ------------------------ GL_ARB_occlusion_query2 ------------------------ */
+#ifndef GL_ARB_occlusion_query2
+#define GL_ARB_occlusion_query2 1
+#define GLEW_ARB_occlusion_query2 GLEW_GET_VAR(__GLEW_ARB_occlusion_query2)
+#endif /* GL_ARB_occlusion_query2 */
+/* --------------------- GL_ARB_parallel_shader_compile -------------------- */
+#ifndef GL_ARB_parallel_shader_compile
+#define GL_ARB_parallel_shader_compile 1
+#define glMaxShaderCompilerThreadsARB GLEW_GET_FUN(__glewMaxShaderCompilerThreadsARB)
+#define GLEW_ARB_parallel_shader_compile GLEW_GET_VAR(__GLEW_ARB_parallel_shader_compile)
+#endif /* GL_ARB_parallel_shader_compile */
+/* -------------------- GL_ARB_pipeline_statistics_query ------------------- */
+#ifndef GL_ARB_pipeline_statistics_query
+#define GL_ARB_pipeline_statistics_query 1
+#define GLEW_ARB_pipeline_statistics_query GLEW_GET_VAR(__GLEW_ARB_pipeline_statistics_query)
+#endif /* GL_ARB_pipeline_statistics_query */
+/* ----------------------- GL_ARB_pixel_buffer_object ---------------------- */
+#ifndef GL_ARB_pixel_buffer_object
+#define GL_ARB_pixel_buffer_object 1
+#define GLEW_ARB_pixel_buffer_object GLEW_GET_VAR(__GLEW_ARB_pixel_buffer_object)
+#endif /* GL_ARB_pixel_buffer_object */
+/* ------------------------ GL_ARB_point_parameters ------------------------ */
+#ifndef GL_ARB_point_parameters
+#define GL_ARB_point_parameters 1
+#define GL_POINT_SIZE_MIN_ARB 0x8126
+#define GL_POINT_SIZE_MAX_ARB 0x8127
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERFARBPROC) (GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERFVARBPROC) (GLenum pname, const GLfloat* params);
+#define glPointParameterfARB GLEW_GET_FUN(__glewPointParameterfARB)
+#define glPointParameterfvARB GLEW_GET_FUN(__glewPointParameterfvARB)
+#define GLEW_ARB_point_parameters GLEW_GET_VAR(__GLEW_ARB_point_parameters)
+#endif /* GL_ARB_point_parameters */
+/* -------------------------- GL_ARB_point_sprite -------------------------- */
+#ifndef GL_ARB_point_sprite
+#define GL_ARB_point_sprite 1
+#define GL_POINT_SPRITE_ARB 0x8861
+#define GL_COORD_REPLACE_ARB 0x8862
+#define GLEW_ARB_point_sprite GLEW_GET_VAR(__GLEW_ARB_point_sprite)
+#endif /* GL_ARB_point_sprite */
+/* ---------------------- GL_ARB_polygon_offset_clamp ---------------------- */
+#ifndef GL_ARB_polygon_offset_clamp
+#define GL_ARB_polygon_offset_clamp 1
+typedef void (GLAPIENTRY * PFNGLPOLYGONOFFSETCLAMPPROC) (GLfloat factor, GLfloat units, GLfloat clamp);
+#define glPolygonOffsetClamp GLEW_GET_FUN(__glewPolygonOffsetClamp)
+#define GLEW_ARB_polygon_offset_clamp GLEW_GET_VAR(__GLEW_ARB_polygon_offset_clamp)
+#endif /* GL_ARB_polygon_offset_clamp */
+/* ----------------------- GL_ARB_post_depth_coverage ---------------------- */
+#ifndef GL_ARB_post_depth_coverage
+#define GL_ARB_post_depth_coverage 1
+#define GLEW_ARB_post_depth_coverage GLEW_GET_VAR(__GLEW_ARB_post_depth_coverage)
+#endif /* GL_ARB_post_depth_coverage */
+/* --------------------- GL_ARB_program_interface_query -------------------- */
+#ifndef GL_ARB_program_interface_query
+#define GL_ARB_program_interface_query 1
+#define GL_UNIFORM 0x92E1
+#define GL_UNIFORM_BLOCK 0x92E2
+#define GL_PROGRAM_INPUT 0x92E3
+#define GL_PROGRAM_OUTPUT 0x92E4
+#define GL_BUFFER_VARIABLE 0x92E5
+#define GL_IS_PER_PATCH 0x92E7
+#define GL_MAX_NAME_LENGTH 0x92F6
+#define GL_NAME_LENGTH 0x92F9
+#define GL_TYPE 0x92FA
+#define GL_ARRAY_SIZE 0x92FB
+#define GL_OFFSET 0x92FC
+#define GL_BLOCK_INDEX 0x92FD
+#define GL_ARRAY_STRIDE 0x92FE
+#define GL_MATRIX_STRIDE 0x92FF
+#define GL_IS_ROW_MAJOR 0x9300
+#define GL_BUFFER_BINDING 0x9302
+#define GL_BUFFER_DATA_SIZE 0x9303
+#define GL_ACTIVE_VARIABLES 0x9305
+#define GL_LOCATION 0x930E
+#define GL_LOCATION_INDEX 0x930F
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMINTERFACEIVPROC) (GLuint program, GLenum programInterface, GLenum pname, GLint* params);
+typedef GLuint (GLAPIENTRY * PFNGLGETPROGRAMRESOURCEINDEXPROC) (GLuint program, GLenum programInterface, const GLchar* name);
+typedef GLint (GLAPIENTRY * PFNGLGETPROGRAMRESOURCELOCATIONPROC) (GLuint program, GLenum programInterface, const GLchar* name);
+typedef GLint (GLAPIENTRY * PFNGLGETPROGRAMRESOURCELOCATIONINDEXPROC) (GLuint program, GLenum programInterface, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMRESOURCENAMEPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei bufSize, GLsizei* length, GLchar *name);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMRESOURCEIVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum* props, GLsizei bufSize, GLsizei *length, GLint *params);
+#define glGetProgramInterfaceiv GLEW_GET_FUN(__glewGetProgramInterfaceiv)
+#define glGetProgramResourceIndex GLEW_GET_FUN(__glewGetProgramResourceIndex)
+#define glGetProgramResourceLocation GLEW_GET_FUN(__glewGetProgramResourceLocation)
+#define glGetProgramResourceLocationIndex GLEW_GET_FUN(__glewGetProgramResourceLocationIndex)
+#define glGetProgramResourceName GLEW_GET_FUN(__glewGetProgramResourceName)
+#define glGetProgramResourceiv GLEW_GET_FUN(__glewGetProgramResourceiv)
+#define GLEW_ARB_program_interface_query GLEW_GET_VAR(__GLEW_ARB_program_interface_query)
+#endif /* GL_ARB_program_interface_query */
+/* ------------------------ GL_ARB_provoking_vertex ------------------------ */
+#ifndef GL_ARB_provoking_vertex
+#define GL_ARB_provoking_vertex 1
+#define glProvokingVertex GLEW_GET_FUN(__glewProvokingVertex)
+#define GLEW_ARB_provoking_vertex GLEW_GET_VAR(__GLEW_ARB_provoking_vertex)
+#endif /* GL_ARB_provoking_vertex */
+/* ----------------------- GL_ARB_query_buffer_object ---------------------- */
+#ifndef GL_ARB_query_buffer_object
+#define GL_ARB_query_buffer_object 1
+#define GL_QUERY_BUFFER_BARRIER_BIT 0x00008000
+#define GL_QUERY_BUFFER 0x9192
+#define GL_QUERY_RESULT_NO_WAIT 0x9194
+#define GLEW_ARB_query_buffer_object GLEW_GET_VAR(__GLEW_ARB_query_buffer_object)
+#endif /* GL_ARB_query_buffer_object */
+/* ------------------ GL_ARB_robust_buffer_access_behavior ----------------- */
+#ifndef GL_ARB_robust_buffer_access_behavior
+#define GL_ARB_robust_buffer_access_behavior 1
+#define GLEW_ARB_robust_buffer_access_behavior GLEW_GET_VAR(__GLEW_ARB_robust_buffer_access_behavior)
+#endif /* GL_ARB_robust_buffer_access_behavior */
+/* --------------------------- GL_ARB_robustness --------------------------- */
+#ifndef GL_ARB_robustness
+#define GL_ARB_robustness 1
+typedef void (GLAPIENTRY * PFNGLGETNCOLORTABLEARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void* table);
+typedef void (GLAPIENTRY * PFNGLGETNCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint lod, GLsizei bufSize, void* img);
+typedef void (GLAPIENTRY * PFNGLGETNCONVOLUTIONFILTERARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void* image);
+typedef void (GLAPIENTRY * PFNGLGETNHISTOGRAMARBPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void* values);
+typedef void (GLAPIENTRY * PFNGLGETNMAPDVARBPROC) (GLenum target, GLenum query, GLsizei bufSize, GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLGETNMAPFVARBPROC) (GLenum target, GLenum query, GLsizei bufSize, GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLGETNMAPIVARBPROC) (GLenum target, GLenum query, GLsizei bufSize, GLint* v);
+typedef void (GLAPIENTRY * PFNGLGETNMINMAXARBPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void* values);
+typedef void (GLAPIENTRY * PFNGLGETNPIXELMAPFVARBPROC) (GLenum map, GLsizei bufSize, GLfloat* values);
+typedef void (GLAPIENTRY * PFNGLGETNPIXELMAPUIVARBPROC) (GLenum map, GLsizei bufSize, GLuint* values);
+typedef void (GLAPIENTRY * PFNGLGETNPIXELMAPUSVARBPROC) (GLenum map, GLsizei bufSize, GLushort* values);
+typedef void (GLAPIENTRY * PFNGLGETNPOLYGONSTIPPLEARBPROC) (GLsizei bufSize, GLubyte* pattern);
+typedef void (GLAPIENTRY * PFNGLGETNSEPARABLEFILTERARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, void* row, GLsizei columnBufSize, void*column, void*span);
+typedef void (GLAPIENTRY * PFNGLGETNTEXIMAGEARBPROC) (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void* img);
+typedef void (GLAPIENTRY * PFNGLGETNUNIFORMDVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLGETNUNIFORMFVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETNUNIFORMIVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETNUNIFORMUIVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLREADNPIXELSARBPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void* data);
+#define glGetGraphicsResetStatusARB GLEW_GET_FUN(__glewGetGraphicsResetStatusARB)
+#define glGetnColorTableARB GLEW_GET_FUN(__glewGetnColorTableARB)
+#define glGetnCompressedTexImageARB GLEW_GET_FUN(__glewGetnCompressedTexImageARB)
+#define glGetnConvolutionFilterARB GLEW_GET_FUN(__glewGetnConvolutionFilterARB)
+#define glGetnHistogramARB GLEW_GET_FUN(__glewGetnHistogramARB)
+#define glGetnMapdvARB GLEW_GET_FUN(__glewGetnMapdvARB)
+#define glGetnMapfvARB GLEW_GET_FUN(__glewGetnMapfvARB)
+#define glGetnMapivARB GLEW_GET_FUN(__glewGetnMapivARB)
+#define glGetnMinmaxARB GLEW_GET_FUN(__glewGetnMinmaxARB)
+#define glGetnPixelMapfvARB GLEW_GET_FUN(__glewGetnPixelMapfvARB)
+#define glGetnPixelMapuivARB GLEW_GET_FUN(__glewGetnPixelMapuivARB)
+#define glGetnPixelMapusvARB GLEW_GET_FUN(__glewGetnPixelMapusvARB)
+#define glGetnPolygonStippleARB GLEW_GET_FUN(__glewGetnPolygonStippleARB)
+#define glGetnSeparableFilterARB GLEW_GET_FUN(__glewGetnSeparableFilterARB)
+#define glGetnTexImageARB GLEW_GET_FUN(__glewGetnTexImageARB)
+#define glGetnUniformdvARB GLEW_GET_FUN(__glewGetnUniformdvARB)
+#define glGetnUniformfvARB GLEW_GET_FUN(__glewGetnUniformfvARB)
+#define glGetnUniformivARB GLEW_GET_FUN(__glewGetnUniformivARB)
+#define glGetnUniformuivARB GLEW_GET_FUN(__glewGetnUniformuivARB)
+#define glReadnPixelsARB GLEW_GET_FUN(__glewReadnPixelsARB)
+#define GLEW_ARB_robustness GLEW_GET_VAR(__GLEW_ARB_robustness)
+#endif /* GL_ARB_robustness */
+/* ---------------- GL_ARB_robustness_application_isolation ---------------- */
+#ifndef GL_ARB_robustness_application_isolation
+#define GL_ARB_robustness_application_isolation 1
+#define GLEW_ARB_robustness_application_isolation GLEW_GET_VAR(__GLEW_ARB_robustness_application_isolation)
+#endif /* GL_ARB_robustness_application_isolation */
+/* ---------------- GL_ARB_robustness_share_group_isolation ---------------- */
+#ifndef GL_ARB_robustness_share_group_isolation
+#define GL_ARB_robustness_share_group_isolation 1
+#define GLEW_ARB_robustness_share_group_isolation GLEW_GET_VAR(__GLEW_ARB_robustness_share_group_isolation)
+#endif /* GL_ARB_robustness_share_group_isolation */
+/* ------------------------ GL_ARB_sample_locations ------------------------ */
+#ifndef GL_ARB_sample_locations
+#define GL_ARB_sample_locations 1
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERSAMPLELOCATIONSFVARBPROC) (GLenum target, GLuint start, GLsizei count, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERSAMPLELOCATIONSFVARBPROC) (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat* v);
+#define glFramebufferSampleLocationsfvARB GLEW_GET_FUN(__glewFramebufferSampleLocationsfvARB)
+#define glNamedFramebufferSampleLocationsfvARB GLEW_GET_FUN(__glewNamedFramebufferSampleLocationsfvARB)
+#define GLEW_ARB_sample_locations GLEW_GET_VAR(__GLEW_ARB_sample_locations)
+#endif /* GL_ARB_sample_locations */
+/* ------------------------- GL_ARB_sample_shading ------------------------- */
+#ifndef GL_ARB_sample_shading
+#define GL_ARB_sample_shading 1
+#define glMinSampleShadingARB GLEW_GET_FUN(__glewMinSampleShadingARB)
+#define GLEW_ARB_sample_shading GLEW_GET_VAR(__GLEW_ARB_sample_shading)
+#endif /* GL_ARB_sample_shading */
+/* ------------------------- GL_ARB_sampler_objects ------------------------ */
+#ifndef GL_ARB_sampler_objects
+#define GL_ARB_sampler_objects 1
+#define GL_SAMPLER_BINDING 0x8919
+typedef void (GLAPIENTRY * PFNGLBINDSAMPLERPROC) (GLuint unit, GLuint sampler);
+typedef void (GLAPIENTRY * PFNGLDELETESAMPLERSPROC) (GLsizei count, const GLuint * samplers);
+typedef void (GLAPIENTRY * PFNGLGENSAMPLERSPROC) (GLsizei count, GLuint* samplers);
+typedef void (GLAPIENTRY * PFNGLGETSAMPLERPARAMETERIIVPROC) (GLuint sampler, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETSAMPLERPARAMETERIUIVPROC) (GLuint sampler, GLenum pname, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETSAMPLERPARAMETERFVPROC) (GLuint sampler, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETSAMPLERPARAMETERIVPROC) (GLuint sampler, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISSAMPLERPROC) (GLuint sampler);
+typedef void (GLAPIENTRY * PFNGLSAMPLERPARAMETERIIVPROC) (GLuint sampler, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLSAMPLERPARAMETERIUIVPROC) (GLuint sampler, GLenum pname, const GLuint* params);
+typedef void (GLAPIENTRY * PFNGLSAMPLERPARAMETERFPROC) (GLuint sampler, GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLSAMPLERPARAMETERFVPROC) (GLuint sampler, GLenum pname, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLSAMPLERPARAMETERIPROC) (GLuint sampler, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLSAMPLERPARAMETERIVPROC) (GLuint sampler, GLenum pname, const GLint* params);
+#define glBindSampler GLEW_GET_FUN(__glewBindSampler)
+#define glDeleteSamplers GLEW_GET_FUN(__glewDeleteSamplers)
+#define glGenSamplers GLEW_GET_FUN(__glewGenSamplers)
+#define glGetSamplerParameterIiv GLEW_GET_FUN(__glewGetSamplerParameterIiv)
+#define glGetSamplerParameterIuiv GLEW_GET_FUN(__glewGetSamplerParameterIuiv)
+#define glGetSamplerParameterfv GLEW_GET_FUN(__glewGetSamplerParameterfv)
+#define glGetSamplerParameteriv GLEW_GET_FUN(__glewGetSamplerParameteriv)
+#define glIsSampler GLEW_GET_FUN(__glewIsSampler)
+#define glSamplerParameterIiv GLEW_GET_FUN(__glewSamplerParameterIiv)
+#define glSamplerParameterIuiv GLEW_GET_FUN(__glewSamplerParameterIuiv)
+#define glSamplerParameterf GLEW_GET_FUN(__glewSamplerParameterf)
+#define glSamplerParameterfv GLEW_GET_FUN(__glewSamplerParameterfv)
+#define glSamplerParameteri GLEW_GET_FUN(__glewSamplerParameteri)
+#define glSamplerParameteriv GLEW_GET_FUN(__glewSamplerParameteriv)
+#define GLEW_ARB_sampler_objects GLEW_GET_VAR(__GLEW_ARB_sampler_objects)
+#endif /* GL_ARB_sampler_objects */
+/* ------------------------ GL_ARB_seamless_cube_map ----------------------- */
+#ifndef GL_ARB_seamless_cube_map
+#define GL_ARB_seamless_cube_map 1
+#define GLEW_ARB_seamless_cube_map GLEW_GET_VAR(__GLEW_ARB_seamless_cube_map)
+#endif /* GL_ARB_seamless_cube_map */
+/* ------------------ GL_ARB_seamless_cubemap_per_texture ------------------ */
+#ifndef GL_ARB_seamless_cubemap_per_texture
+#define GL_ARB_seamless_cubemap_per_texture 1
+#define GLEW_ARB_seamless_cubemap_per_texture GLEW_GET_VAR(__GLEW_ARB_seamless_cubemap_per_texture)
+#endif /* GL_ARB_seamless_cubemap_per_texture */
+/* --------------------- GL_ARB_separate_shader_objects -------------------- */
+#ifndef GL_ARB_separate_shader_objects
+#define GL_ARB_separate_shader_objects 1
+#define GL_VERTEX_SHADER_BIT 0x00000001
+#define GL_FRAGMENT_SHADER_BIT 0x00000002
+#define GL_GEOMETRY_SHADER_BIT 0x00000004
+#define GL_TESS_CONTROL_SHADER_BIT 0x00000008
+#define GL_PROGRAM_SEPARABLE 0x8258
+#define GL_ACTIVE_PROGRAM 0x8259
+typedef void (GLAPIENTRY * PFNGLACTIVESHADERPROGRAMPROC) (GLuint pipeline, GLuint program);
+typedef GLuint (GLAPIENTRY * PFNGLCREATESHADERPROGRAMVPROC) (GLenum type, GLsizei count, const GLchar * const * strings);
+typedef void (GLAPIENTRY * PFNGLDELETEPROGRAMPIPELINESPROC) (GLsizei n, const GLuint* pipelines);
+typedef void (GLAPIENTRY * PFNGLGENPROGRAMPIPELINESPROC) (GLsizei n, GLuint* pipelines);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMPIPELINEINFOLOGPROC) (GLuint pipeline, GLsizei bufSize, GLsizei* length, GLchar *infoLog);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMPIPELINEIVPROC) (GLuint pipeline, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1DPROC) (GLuint program, GLint location, GLdouble x);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1FPROC) (GLuint program, GLint location, GLfloat x);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1IPROC) (GLuint program, GLint location, GLint x);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1IVPROC) (GLuint program, GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1UIPROC) (GLuint program, GLint location, GLuint x);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2DPROC) (GLuint program, GLint location, GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2FPROC) (GLuint program, GLint location, GLfloat x, GLfloat y);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2IPROC) (GLuint program, GLint location, GLint x, GLint y);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2IVPROC) (GLuint program, GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2UIPROC) (GLuint program, GLint location, GLuint x, GLuint y);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3DPROC) (GLuint program, GLint location, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3FPROC) (GLuint program, GLint location, GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3IPROC) (GLuint program, GLint location, GLint x, GLint y, GLint z);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3IVPROC) (GLuint program, GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3UIPROC) (GLuint program, GLint location, GLuint x, GLuint y, GLuint z);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4DPROC) (GLuint program, GLint location, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4FPROC) (GLuint program, GLint location, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4IPROC) (GLuint program, GLint location, GLint x, GLint y, GLint z, GLint w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4IVPROC) (GLuint program, GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4UIPROC) (GLuint program, GLint location, GLuint x, GLuint y, GLuint z, GLuint w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX2DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX2FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX2X3DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX2X3FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX2X4DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX2X4FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX3DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX3FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX3X2DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX3X2FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX3X4DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX3X4FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX4DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX4FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX4X2DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX4X2FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX4X3DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX4X3FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUSEPROGRAMSTAGESPROC) (GLuint pipeline, GLbitfield stages, GLuint program);
+#define glActiveShaderProgram GLEW_GET_FUN(__glewActiveShaderProgram)
+#define glBindProgramPipeline GLEW_GET_FUN(__glewBindProgramPipeline)
+#define glCreateShaderProgramv GLEW_GET_FUN(__glewCreateShaderProgramv)
+#define glDeleteProgramPipelines GLEW_GET_FUN(__glewDeleteProgramPipelines)
+#define glGenProgramPipelines GLEW_GET_FUN(__glewGenProgramPipelines)
+#define glGetProgramPipelineInfoLog GLEW_GET_FUN(__glewGetProgramPipelineInfoLog)
+#define glGetProgramPipelineiv GLEW_GET_FUN(__glewGetProgramPipelineiv)
+#define glIsProgramPipeline GLEW_GET_FUN(__glewIsProgramPipeline)
+#define glProgramUniform1d GLEW_GET_FUN(__glewProgramUniform1d)
+#define glProgramUniform1dv GLEW_GET_FUN(__glewProgramUniform1dv)
+#define glProgramUniform1f GLEW_GET_FUN(__glewProgramUniform1f)
+#define glProgramUniform1fv GLEW_GET_FUN(__glewProgramUniform1fv)
+#define glProgramUniform1i GLEW_GET_FUN(__glewProgramUniform1i)
+#define glProgramUniform1iv GLEW_GET_FUN(__glewProgramUniform1iv)
+#define glProgramUniform1ui GLEW_GET_FUN(__glewProgramUniform1ui)
+#define glProgramUniform1uiv GLEW_GET_FUN(__glewProgramUniform1uiv)
+#define glProgramUniform2d GLEW_GET_FUN(__glewProgramUniform2d)
+#define glProgramUniform2dv GLEW_GET_FUN(__glewProgramUniform2dv)
+#define glProgramUniform2f GLEW_GET_FUN(__glewProgramUniform2f)
+#define glProgramUniform2fv GLEW_GET_FUN(__glewProgramUniform2fv)
+#define glProgramUniform2i GLEW_GET_FUN(__glewProgramUniform2i)
+#define glProgramUniform2iv GLEW_GET_FUN(__glewProgramUniform2iv)
+#define glProgramUniform2ui GLEW_GET_FUN(__glewProgramUniform2ui)
+#define glProgramUniform2uiv GLEW_GET_FUN(__glewProgramUniform2uiv)
+#define glProgramUniform3d GLEW_GET_FUN(__glewProgramUniform3d)
+#define glProgramUniform3dv GLEW_GET_FUN(__glewProgramUniform3dv)
+#define glProgramUniform3f GLEW_GET_FUN(__glewProgramUniform3f)
+#define glProgramUniform3fv GLEW_GET_FUN(__glewProgramUniform3fv)
+#define glProgramUniform3i GLEW_GET_FUN(__glewProgramUniform3i)
+#define glProgramUniform3iv GLEW_GET_FUN(__glewProgramUniform3iv)
+#define glProgramUniform3ui GLEW_GET_FUN(__glewProgramUniform3ui)
+#define glProgramUniform3uiv GLEW_GET_FUN(__glewProgramUniform3uiv)
+#define glProgramUniform4d GLEW_GET_FUN(__glewProgramUniform4d)
+#define glProgramUniform4dv GLEW_GET_FUN(__glewProgramUniform4dv)
+#define glProgramUniform4f GLEW_GET_FUN(__glewProgramUniform4f)
+#define glProgramUniform4fv GLEW_GET_FUN(__glewProgramUniform4fv)
+#define glProgramUniform4i GLEW_GET_FUN(__glewProgramUniform4i)
+#define glProgramUniform4iv GLEW_GET_FUN(__glewProgramUniform4iv)
+#define glProgramUniform4ui GLEW_GET_FUN(__glewProgramUniform4ui)
+#define glProgramUniform4uiv GLEW_GET_FUN(__glewProgramUniform4uiv)
+#define glProgramUniformMatrix2dv GLEW_GET_FUN(__glewProgramUniformMatrix2dv)
+#define glProgramUniformMatrix2fv GLEW_GET_FUN(__glewProgramUniformMatrix2fv)
+#define glProgramUniformMatrix2x3dv GLEW_GET_FUN(__glewProgramUniformMatrix2x3dv)
+#define glProgramUniformMatrix2x3fv GLEW_GET_FUN(__glewProgramUniformMatrix2x3fv)
+#define glProgramUniformMatrix2x4dv GLEW_GET_FUN(__glewProgramUniformMatrix2x4dv)
+#define glProgramUniformMatrix2x4fv GLEW_GET_FUN(__glewProgramUniformMatrix2x4fv)
+#define glProgramUniformMatrix3dv GLEW_GET_FUN(__glewProgramUniformMatrix3dv)
+#define glProgramUniformMatrix3fv GLEW_GET_FUN(__glewProgramUniformMatrix3fv)
+#define glProgramUniformMatrix3x2dv GLEW_GET_FUN(__glewProgramUniformMatrix3x2dv)
+#define glProgramUniformMatrix3x2fv GLEW_GET_FUN(__glewProgramUniformMatrix3x2fv)
+#define glProgramUniformMatrix3x4dv GLEW_GET_FUN(__glewProgramUniformMatrix3x4dv)
+#define glProgramUniformMatrix3x4fv GLEW_GET_FUN(__glewProgramUniformMatrix3x4fv)
+#define glProgramUniformMatrix4dv GLEW_GET_FUN(__glewProgramUniformMatrix4dv)
+#define glProgramUniformMatrix4fv GLEW_GET_FUN(__glewProgramUniformMatrix4fv)
+#define glProgramUniformMatrix4x2dv GLEW_GET_FUN(__glewProgramUniformMatrix4x2dv)
+#define glProgramUniformMatrix4x2fv GLEW_GET_FUN(__glewProgramUniformMatrix4x2fv)
+#define glProgramUniformMatrix4x3dv GLEW_GET_FUN(__glewProgramUniformMatrix4x3dv)
+#define glProgramUniformMatrix4x3fv GLEW_GET_FUN(__glewProgramUniformMatrix4x3fv)
+#define glUseProgramStages GLEW_GET_FUN(__glewUseProgramStages)
+#define glValidateProgramPipeline GLEW_GET_FUN(__glewValidateProgramPipeline)
+#define GLEW_ARB_separate_shader_objects GLEW_GET_VAR(__GLEW_ARB_separate_shader_objects)
+#endif /* GL_ARB_separate_shader_objects */
+/* -------------------- GL_ARB_shader_atomic_counter_ops ------------------- */
+#ifndef GL_ARB_shader_atomic_counter_ops
+#define GL_ARB_shader_atomic_counter_ops 1
+#define GLEW_ARB_shader_atomic_counter_ops GLEW_GET_VAR(__GLEW_ARB_shader_atomic_counter_ops)
+#endif /* GL_ARB_shader_atomic_counter_ops */
+/* --------------------- GL_ARB_shader_atomic_counters --------------------- */
+#ifndef GL_ARB_shader_atomic_counters
+#define GL_ARB_shader_atomic_counters 1
+typedef void (GLAPIENTRY * PFNGLGETACTIVEATOMICCOUNTERBUFFERIVPROC) (GLuint program, GLuint bufferIndex, GLenum pname, GLint* params);
+#define glGetActiveAtomicCounterBufferiv GLEW_GET_FUN(__glewGetActiveAtomicCounterBufferiv)
+#define GLEW_ARB_shader_atomic_counters GLEW_GET_VAR(__GLEW_ARB_shader_atomic_counters)
+#endif /* GL_ARB_shader_atomic_counters */
+/* -------------------------- GL_ARB_shader_ballot ------------------------- */
+#ifndef GL_ARB_shader_ballot
+#define GL_ARB_shader_ballot 1
+#define GLEW_ARB_shader_ballot GLEW_GET_VAR(__GLEW_ARB_shader_ballot)
+#endif /* GL_ARB_shader_ballot */
+/* ----------------------- GL_ARB_shader_bit_encoding ---------------------- */
+#ifndef GL_ARB_shader_bit_encoding
+#define GL_ARB_shader_bit_encoding 1
+#define GLEW_ARB_shader_bit_encoding GLEW_GET_VAR(__GLEW_ARB_shader_bit_encoding)
+#endif /* GL_ARB_shader_bit_encoding */
+/* -------------------------- GL_ARB_shader_clock -------------------------- */
+#ifndef GL_ARB_shader_clock
+#define GL_ARB_shader_clock 1
+#define GLEW_ARB_shader_clock GLEW_GET_VAR(__GLEW_ARB_shader_clock)
+#endif /* GL_ARB_shader_clock */
+/* --------------------- GL_ARB_shader_draw_parameters --------------------- */
+#ifndef GL_ARB_shader_draw_parameters
+#define GL_ARB_shader_draw_parameters 1
+#define GLEW_ARB_shader_draw_parameters GLEW_GET_VAR(__GLEW_ARB_shader_draw_parameters)
+#endif /* GL_ARB_shader_draw_parameters */
+/* ------------------------ GL_ARB_shader_group_vote ----------------------- */
+#ifndef GL_ARB_shader_group_vote
+#define GL_ARB_shader_group_vote 1
+#define GLEW_ARB_shader_group_vote GLEW_GET_VAR(__GLEW_ARB_shader_group_vote)
+#endif /* GL_ARB_shader_group_vote */
+/* --------------------- GL_ARB_shader_image_load_store -------------------- */
+#ifndef GL_ARB_shader_image_load_store
+#define GL_ARB_shader_image_load_store 1
+#define GL_ELEMENT_ARRAY_BARRIER_BIT 0x00000002
+#define GL_UNIFORM_BARRIER_BIT 0x00000004
+#define GL_TEXTURE_FETCH_BARRIER_BIT 0x00000008
+#define GL_COMMAND_BARRIER_BIT 0x00000040
+#define GL_PIXEL_BUFFER_BARRIER_BIT 0x00000080
+#define GL_BUFFER_UPDATE_BARRIER_BIT 0x00000200
+#define GL_FRAMEBUFFER_BARRIER_BIT 0x00000400
+#define GL_MAX_IMAGE_UNITS 0x8F38
+#define GL_IMAGE_1D 0x904C
+#define GL_IMAGE_2D 0x904D
+#define GL_IMAGE_3D 0x904E
+#define GL_IMAGE_2D_RECT 0x904F
+#define GL_IMAGE_CUBE 0x9050
+#define GL_IMAGE_BUFFER 0x9051
+#define GL_IMAGE_1D_ARRAY 0x9052
+#define GL_IMAGE_2D_ARRAY 0x9053
+#define GL_IMAGE_CUBE_MAP_ARRAY 0x9054
+#define GL_IMAGE_2D_MULTISAMPLE 0x9055
+#define GL_INT_IMAGE_1D 0x9057
+#define GL_INT_IMAGE_2D 0x9058
+#define GL_INT_IMAGE_3D 0x9059
+#define GL_INT_IMAGE_2D_RECT 0x905A
+#define GL_INT_IMAGE_CUBE 0x905B
+#define GL_INT_IMAGE_BUFFER 0x905C
+#define GL_INT_IMAGE_1D_ARRAY 0x905D
+#define GL_INT_IMAGE_2D_ARRAY 0x905E
+#define GL_UNSIGNED_INT_IMAGE_1D 0x9062
+#define GL_UNSIGNED_INT_IMAGE_2D 0x9063
+#define GL_UNSIGNED_INT_IMAGE_3D 0x9064
+#define GL_MAX_IMAGE_SAMPLES 0x906D
+typedef void (GLAPIENTRY * PFNGLBINDIMAGETEXTUREPROC) (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format);
+typedef void (GLAPIENTRY * PFNGLMEMORYBARRIERPROC) (GLbitfield barriers);
+#define glBindImageTexture GLEW_GET_FUN(__glewBindImageTexture)
+#define glMemoryBarrier GLEW_GET_FUN(__glewMemoryBarrier)
+#define GLEW_ARB_shader_image_load_store GLEW_GET_VAR(__GLEW_ARB_shader_image_load_store)
+#endif /* GL_ARB_shader_image_load_store */
+/* ------------------------ GL_ARB_shader_image_size ----------------------- */
+#ifndef GL_ARB_shader_image_size
+#define GL_ARB_shader_image_size 1
+#define GLEW_ARB_shader_image_size GLEW_GET_VAR(__GLEW_ARB_shader_image_size)
+#endif /* GL_ARB_shader_image_size */
+/* ------------------------- GL_ARB_shader_objects ------------------------- */
+#ifndef GL_ARB_shader_objects
+#define GL_ARB_shader_objects 1
+#define GL_SHADER_OBJECT_ARB 0x8B48
+#define GL_OBJECT_TYPE_ARB 0x8B4E
+#define GL_FLOAT_VEC2_ARB 0x8B50
+#define GL_FLOAT_VEC3_ARB 0x8B51
+#define GL_FLOAT_VEC4_ARB 0x8B52
+#define GL_INT_VEC2_ARB 0x8B53
+#define GL_INT_VEC3_ARB 0x8B54
+#define GL_INT_VEC4_ARB 0x8B55
+#define GL_BOOL_ARB 0x8B56
+#define GL_BOOL_VEC2_ARB 0x8B57
+#define GL_BOOL_VEC3_ARB 0x8B58
+#define GL_BOOL_VEC4_ARB 0x8B59
+#define GL_FLOAT_MAT2_ARB 0x8B5A
+#define GL_FLOAT_MAT3_ARB 0x8B5B
+#define GL_FLOAT_MAT4_ARB 0x8B5C
+#define GL_SAMPLER_1D_ARB 0x8B5D
+#define GL_SAMPLER_2D_ARB 0x8B5E
+#define GL_SAMPLER_3D_ARB 0x8B5F
+#define GL_SAMPLER_CUBE_ARB 0x8B60
+#define GL_SAMPLER_1D_SHADOW_ARB 0x8B61
+#define GL_SAMPLER_2D_SHADOW_ARB 0x8B62
+#define GL_SAMPLER_2D_RECT_ARB 0x8B63
+typedef char GLcharARB;
+typedef unsigned int GLhandleARB;
+typedef void (GLAPIENTRY * PFNGLATTACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB obj);
+typedef void (GLAPIENTRY * PFNGLDETACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB attachedObj);
+typedef void (GLAPIENTRY * PFNGLGETACTIVEUNIFORMARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei* length, GLint *size, GLenum *type, GLcharARB *name);
+typedef void (GLAPIENTRY * PFNGLGETATTACHEDOBJECTSARBPROC) (GLhandleARB containerObj, GLsizei maxCount, GLsizei* count, GLhandleARB *obj);
+typedef void (GLAPIENTRY * PFNGLGETINFOLOGARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei* length, GLcharARB *infoLog);
+typedef void (GLAPIENTRY * PFNGLGETOBJECTPARAMETERFVARBPROC) (GLhandleARB obj, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETOBJECTPARAMETERIVARBPROC) (GLhandleARB obj, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETSHADERSOURCEARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei* length, GLcharARB *source);
+typedef GLint (GLAPIENTRY * PFNGLGETUNIFORMLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB* name);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMFVARBPROC) (GLhandleARB programObj, GLint location, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMIVARBPROC) (GLhandleARB programObj, GLint location, GLint* params);
+typedef void (GLAPIENTRY * PFNGLLINKPROGRAMARBPROC) (GLhandleARB programObj);
+typedef void (GLAPIENTRY * PFNGLSHADERSOURCEARBPROC) (GLhandleARB shaderObj, GLsizei count, const GLcharARB ** string, const GLint *length);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1FARBPROC) (GLint location, GLfloat v0);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1FVARBPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1IARBPROC) (GLint location, GLint v0);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1IVARBPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2FARBPROC) (GLint location, GLfloat v0, GLfloat v1);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2FVARBPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2IARBPROC) (GLint location, GLint v0, GLint v1);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2IVARBPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3FVARBPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3IVARBPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4FVARBPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4IVARBPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+#define glAttachObjectARB GLEW_GET_FUN(__glewAttachObjectARB)
+#define glCompileShaderARB GLEW_GET_FUN(__glewCompileShaderARB)
+#define glCreateProgramObjectARB GLEW_GET_FUN(__glewCreateProgramObjectARB)
+#define glCreateShaderObjectARB GLEW_GET_FUN(__glewCreateShaderObjectARB)
+#define glDeleteObjectARB GLEW_GET_FUN(__glewDeleteObjectARB)
+#define glDetachObjectARB GLEW_GET_FUN(__glewDetachObjectARB)
+#define glGetActiveUniformARB GLEW_GET_FUN(__glewGetActiveUniformARB)
+#define glGetAttachedObjectsARB GLEW_GET_FUN(__glewGetAttachedObjectsARB)
+#define glGetHandleARB GLEW_GET_FUN(__glewGetHandleARB)
+#define glGetInfoLogARB GLEW_GET_FUN(__glewGetInfoLogARB)
+#define glGetObjectParameterfvARB GLEW_GET_FUN(__glewGetObjectParameterfvARB)
+#define glGetObjectParameterivARB GLEW_GET_FUN(__glewGetObjectParameterivARB)
+#define glGetShaderSourceARB GLEW_GET_FUN(__glewGetShaderSourceARB)
+#define glGetUniformLocationARB GLEW_GET_FUN(__glewGetUniformLocationARB)
+#define glGetUniformfvARB GLEW_GET_FUN(__glewGetUniformfvARB)
+#define glGetUniformivARB GLEW_GET_FUN(__glewGetUniformivARB)
+#define glLinkProgramARB GLEW_GET_FUN(__glewLinkProgramARB)
+#define glShaderSourceARB GLEW_GET_FUN(__glewShaderSourceARB)
+#define glUniform1fARB GLEW_GET_FUN(__glewUniform1fARB)
+#define glUniform1fvARB GLEW_GET_FUN(__glewUniform1fvARB)
+#define glUniform1iARB GLEW_GET_FUN(__glewUniform1iARB)
+#define glUniform1ivARB GLEW_GET_FUN(__glewUniform1ivARB)
+#define glUniform2fARB GLEW_GET_FUN(__glewUniform2fARB)
+#define glUniform2fvARB GLEW_GET_FUN(__glewUniform2fvARB)
+#define glUniform2iARB GLEW_GET_FUN(__glewUniform2iARB)
+#define glUniform2ivARB GLEW_GET_FUN(__glewUniform2ivARB)
+#define glUniform3fARB GLEW_GET_FUN(__glewUniform3fARB)
+#define glUniform3fvARB GLEW_GET_FUN(__glewUniform3fvARB)
+#define glUniform3iARB GLEW_GET_FUN(__glewUniform3iARB)
+#define glUniform3ivARB GLEW_GET_FUN(__glewUniform3ivARB)
+#define glUniform4fARB GLEW_GET_FUN(__glewUniform4fARB)
+#define glUniform4fvARB GLEW_GET_FUN(__glewUniform4fvARB)
+#define glUniform4iARB GLEW_GET_FUN(__glewUniform4iARB)
+#define glUniform4ivARB GLEW_GET_FUN(__glewUniform4ivARB)
+#define glUniformMatrix2fvARB GLEW_GET_FUN(__glewUniformMatrix2fvARB)
+#define glUniformMatrix3fvARB GLEW_GET_FUN(__glewUniformMatrix3fvARB)
+#define glUniformMatrix4fvARB GLEW_GET_FUN(__glewUniformMatrix4fvARB)
+#define glUseProgramObjectARB GLEW_GET_FUN(__glewUseProgramObjectARB)
+#define glValidateProgramARB GLEW_GET_FUN(__glewValidateProgramARB)
+#define GLEW_ARB_shader_objects GLEW_GET_VAR(__GLEW_ARB_shader_objects)
+#endif /* GL_ARB_shader_objects */
+/* ------------------------ GL_ARB_shader_precision ------------------------ */
+#ifndef GL_ARB_shader_precision
+#define GL_ARB_shader_precision 1
+#define GLEW_ARB_shader_precision GLEW_GET_VAR(__GLEW_ARB_shader_precision)
+#endif /* GL_ARB_shader_precision */
+/* ---------------------- GL_ARB_shader_stencil_export --------------------- */
+#ifndef GL_ARB_shader_stencil_export
+#define GL_ARB_shader_stencil_export 1
+#define GLEW_ARB_shader_stencil_export GLEW_GET_VAR(__GLEW_ARB_shader_stencil_export)
+#endif /* GL_ARB_shader_stencil_export */
+/* ------------------ GL_ARB_shader_storage_buffer_object ------------------ */
+#ifndef GL_ARB_shader_storage_buffer_object
+#define GL_ARB_shader_storage_buffer_object 1
+typedef void (GLAPIENTRY * PFNGLSHADERSTORAGEBLOCKBINDINGPROC) (GLuint program, GLuint storageBlockIndex, GLuint storageBlockBinding);
+#define glShaderStorageBlockBinding GLEW_GET_FUN(__glewShaderStorageBlockBinding)
+#define GLEW_ARB_shader_storage_buffer_object GLEW_GET_VAR(__GLEW_ARB_shader_storage_buffer_object)
+#endif /* GL_ARB_shader_storage_buffer_object */
+/* ------------------------ GL_ARB_shader_subroutine ----------------------- */
+#ifndef GL_ARB_shader_subroutine
+#define GL_ARB_shader_subroutine 1
+typedef void (GLAPIENTRY * PFNGLGETACTIVESUBROUTINENAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei* length, GLchar *name);
+typedef void (GLAPIENTRY * PFNGLGETACTIVESUBROUTINEUNIFORMNAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei* length, GLchar *name);
+typedef void (GLAPIENTRY * PFNGLGETACTIVESUBROUTINEUNIFORMIVPROC) (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint* values);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMSTAGEIVPROC) (GLuint program, GLenum shadertype, GLenum pname, GLint* values);
+typedef GLuint (GLAPIENTRY * PFNGLGETSUBROUTINEINDEXPROC) (GLuint program, GLenum shadertype, const GLchar* name);
+typedef GLint (GLAPIENTRY * PFNGLGETSUBROUTINEUNIFORMLOCATIONPROC) (GLuint program, GLenum shadertype, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMSUBROUTINEUIVPROC) (GLenum shadertype, GLint location, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLUNIFORMSUBROUTINESUIVPROC) (GLenum shadertype, GLsizei count, const GLuint* indices);
+#define glGetActiveSubroutineName GLEW_GET_FUN(__glewGetActiveSubroutineName)
+#define glGetActiveSubroutineUniformName GLEW_GET_FUN(__glewGetActiveSubroutineUniformName)
+#define glGetActiveSubroutineUniformiv GLEW_GET_FUN(__glewGetActiveSubroutineUniformiv)
+#define glGetProgramStageiv GLEW_GET_FUN(__glewGetProgramStageiv)
+#define glGetSubroutineIndex GLEW_GET_FUN(__glewGetSubroutineIndex)
+#define glGetSubroutineUniformLocation GLEW_GET_FUN(__glewGetSubroutineUniformLocation)
+#define glGetUniformSubroutineuiv GLEW_GET_FUN(__glewGetUniformSubroutineuiv)
+#define glUniformSubroutinesuiv GLEW_GET_FUN(__glewUniformSubroutinesuiv)
+#define GLEW_ARB_shader_subroutine GLEW_GET_VAR(__GLEW_ARB_shader_subroutine)
+#endif /* GL_ARB_shader_subroutine */
+/* ------------------ GL_ARB_shader_texture_image_samples ------------------ */
+#ifndef GL_ARB_shader_texture_image_samples
+#define GL_ARB_shader_texture_image_samples 1
+#define GLEW_ARB_shader_texture_image_samples GLEW_GET_VAR(__GLEW_ARB_shader_texture_image_samples)
+#endif /* GL_ARB_shader_texture_image_samples */
+/* ----------------------- GL_ARB_shader_texture_lod ----------------------- */
+#ifndef GL_ARB_shader_texture_lod
+#define GL_ARB_shader_texture_lod 1
+#define GLEW_ARB_shader_texture_lod GLEW_GET_VAR(__GLEW_ARB_shader_texture_lod)
+#endif /* GL_ARB_shader_texture_lod */
+/* ------------------- GL_ARB_shader_viewport_layer_array ------------------ */
+#ifndef GL_ARB_shader_viewport_layer_array
+#define GL_ARB_shader_viewport_layer_array 1
+#define GLEW_ARB_shader_viewport_layer_array GLEW_GET_VAR(__GLEW_ARB_shader_viewport_layer_array)
+#endif /* GL_ARB_shader_viewport_layer_array */
+/* ---------------------- GL_ARB_shading_language_100 ---------------------- */
+#ifndef GL_ARB_shading_language_100
+#define GL_ARB_shading_language_100 1
+#define GLEW_ARB_shading_language_100 GLEW_GET_VAR(__GLEW_ARB_shading_language_100)
+#endif /* GL_ARB_shading_language_100 */
+/* -------------------- GL_ARB_shading_language_420pack -------------------- */
+#ifndef GL_ARB_shading_language_420pack
+#define GL_ARB_shading_language_420pack 1
+#define GLEW_ARB_shading_language_420pack GLEW_GET_VAR(__GLEW_ARB_shading_language_420pack)
+#endif /* GL_ARB_shading_language_420pack */
+/* -------------------- GL_ARB_shading_language_include -------------------- */
+#ifndef GL_ARB_shading_language_include
+#define GL_ARB_shading_language_include 1
+typedef void (GLAPIENTRY * PFNGLCOMPILESHADERINCLUDEARBPROC) (GLuint shader, GLsizei count, const GLchar* const *path, const GLint *length);
+typedef void (GLAPIENTRY * PFNGLDELETENAMEDSTRINGARBPROC) (GLint namelen, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDSTRINGARBPROC) (GLint namelen, const GLchar* name, GLsizei bufSize, GLint *stringlen, GLchar *string);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDSTRINGIVARBPROC) (GLint namelen, const GLchar* name, GLenum pname, GLint *params);
+typedef GLboolean (GLAPIENTRY * PFNGLISNAMEDSTRINGARBPROC) (GLint namelen, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLNAMEDSTRINGARBPROC) (GLenum type, GLint namelen, const GLchar* name, GLint stringlen, const GLchar *string);
+#define glCompileShaderIncludeARB GLEW_GET_FUN(__glewCompileShaderIncludeARB)
+#define glDeleteNamedStringARB GLEW_GET_FUN(__glewDeleteNamedStringARB)
+#define glGetNamedStringARB GLEW_GET_FUN(__glewGetNamedStringARB)
+#define glGetNamedStringivARB GLEW_GET_FUN(__glewGetNamedStringivARB)
+#define glIsNamedStringARB GLEW_GET_FUN(__glewIsNamedStringARB)
+#define glNamedStringARB GLEW_GET_FUN(__glewNamedStringARB)
+#define GLEW_ARB_shading_language_include GLEW_GET_VAR(__GLEW_ARB_shading_language_include)
+#endif /* GL_ARB_shading_language_include */
+/* -------------------- GL_ARB_shading_language_packing -------------------- */
+#ifndef GL_ARB_shading_language_packing
+#define GL_ARB_shading_language_packing 1
+#define GLEW_ARB_shading_language_packing GLEW_GET_VAR(__GLEW_ARB_shading_language_packing)
+#endif /* GL_ARB_shading_language_packing */
+/* ----------------------------- GL_ARB_shadow ----------------------------- */
+#ifndef GL_ARB_shadow
+#define GL_ARB_shadow 1
+#define GLEW_ARB_shadow GLEW_GET_VAR(__GLEW_ARB_shadow)
+#endif /* GL_ARB_shadow */
+/* ------------------------- GL_ARB_shadow_ambient ------------------------- */
+#ifndef GL_ARB_shadow_ambient
+#define GL_ARB_shadow_ambient 1
+#define GLEW_ARB_shadow_ambient GLEW_GET_VAR(__GLEW_ARB_shadow_ambient)
+#endif /* GL_ARB_shadow_ambient */
+/* -------------------------- GL_ARB_sparse_buffer ------------------------- */
+#ifndef GL_ARB_sparse_buffer
+#define GL_ARB_sparse_buffer 1
+typedef void (GLAPIENTRY * PFNGLBUFFERPAGECOMMITMENTARBPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLboolean commit);
+#define glBufferPageCommitmentARB GLEW_GET_FUN(__glewBufferPageCommitmentARB)
+#define GLEW_ARB_sparse_buffer GLEW_GET_VAR(__GLEW_ARB_sparse_buffer)
+#endif /* GL_ARB_sparse_buffer */
+/* ------------------------- GL_ARB_sparse_texture ------------------------- */
+#ifndef GL_ARB_sparse_texture
+#define GL_ARB_sparse_texture 1
+#define GL_VIRTUAL_PAGE_SIZE_X_ARB 0x9195
+#define GL_VIRTUAL_PAGE_SIZE_Y_ARB 0x9196
+#define GL_VIRTUAL_PAGE_SIZE_Z_ARB 0x9197
+typedef void (GLAPIENTRY * PFNGLTEXPAGECOMMITMENTARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit);
+#define glTexPageCommitmentARB GLEW_GET_FUN(__glewTexPageCommitmentARB)
+#define GLEW_ARB_sparse_texture GLEW_GET_VAR(__GLEW_ARB_sparse_texture)
+#endif /* GL_ARB_sparse_texture */
+/* ------------------------- GL_ARB_sparse_texture2 ------------------------ */
+#ifndef GL_ARB_sparse_texture2
+#define GL_ARB_sparse_texture2 1
+#define GLEW_ARB_sparse_texture2 GLEW_GET_VAR(__GLEW_ARB_sparse_texture2)
+#endif /* GL_ARB_sparse_texture2 */
+/* ---------------------- GL_ARB_sparse_texture_clamp ---------------------- */
+#ifndef GL_ARB_sparse_texture_clamp
+#define GL_ARB_sparse_texture_clamp 1
+#define GLEW_ARB_sparse_texture_clamp GLEW_GET_VAR(__GLEW_ARB_sparse_texture_clamp)
+#endif /* GL_ARB_sparse_texture_clamp */
+/* ------------------------ GL_ARB_spirv_extensions ------------------------ */
+#ifndef GL_ARB_spirv_extensions
+#define GL_ARB_spirv_extensions 1
+#define GL_SPIR_V_EXTENSIONS 0x9553
+#define GL_NUM_SPIR_V_EXTENSIONS 0x9554
+#define GLEW_ARB_spirv_extensions GLEW_GET_VAR(__GLEW_ARB_spirv_extensions)
+#endif /* GL_ARB_spirv_extensions */
+/* ------------------------ GL_ARB_stencil_texturing ----------------------- */
+#ifndef GL_ARB_stencil_texturing
+#define GL_ARB_stencil_texturing 1
+#define GLEW_ARB_stencil_texturing GLEW_GET_VAR(__GLEW_ARB_stencil_texturing)
+#endif /* GL_ARB_stencil_texturing */
+/* ------------------------------ GL_ARB_sync ------------------------------ */
+#ifndef GL_ARB_sync
+#define GL_ARB_sync 1
+#define GL_SYNC_FLUSH_COMMANDS_BIT 0x00000001
+#define GL_OBJECT_TYPE 0x9112
+#define GL_SYNC_CONDITION 0x9113
+#define GL_SYNC_STATUS 0x9114
+#define GL_SYNC_FLAGS 0x9115
+#define GL_SYNC_FENCE 0x9116
+#define GL_UNSIGNALED 0x9118
+#define GL_SIGNALED 0x9119
+#define GL_TIMEOUT_EXPIRED 0x911B
+#define GL_WAIT_FAILED 0x911D
+typedef GLenum (GLAPIENTRY * PFNGLCLIENTWAITSYNCPROC) (GLsync GLsync,GLbitfield flags,GLuint64 timeout);
+typedef GLsync (GLAPIENTRY * PFNGLFENCESYNCPROC) (GLenum condition,GLbitfield flags);
+typedef void (GLAPIENTRY * PFNGLGETINTEGER64VPROC) (GLenum pname, GLint64* params);
+typedef void (GLAPIENTRY * PFNGLGETSYNCIVPROC) (GLsync GLsync,GLenum pname,GLsizei bufSize,GLsizei* length, GLint *values);
+typedef GLboolean (GLAPIENTRY * PFNGLISSYNCPROC) (GLsync GLsync);
+typedef void (GLAPIENTRY * PFNGLWAITSYNCPROC) (GLsync GLsync,GLbitfield flags,GLuint64 timeout);
+#define glClientWaitSync GLEW_GET_FUN(__glewClientWaitSync)
+#define glDeleteSync GLEW_GET_FUN(__glewDeleteSync)
+#define glFenceSync GLEW_GET_FUN(__glewFenceSync)
+#define glGetInteger64v GLEW_GET_FUN(__glewGetInteger64v)
+#define glGetSynciv GLEW_GET_FUN(__glewGetSynciv)
+#define glIsSync GLEW_GET_FUN(__glewIsSync)
+#define glWaitSync GLEW_GET_FUN(__glewWaitSync)
+#define GLEW_ARB_sync GLEW_GET_VAR(__GLEW_ARB_sync)
+#endif /* GL_ARB_sync */
+/* ----------------------- GL_ARB_tessellation_shader ---------------------- */
+#ifndef GL_ARB_tessellation_shader
+#define GL_ARB_tessellation_shader 1
+#define GL_PATCHES 0xE
+#define GL_PATCH_VERTICES 0x8E72
+#define GL_TESS_GEN_MODE 0x8E76
+#define GL_TESS_GEN_SPACING 0x8E77
+#define GL_TESS_GEN_POINT_MODE 0x8E79
+#define GL_ISOLINES 0x8E7A
+typedef void (GLAPIENTRY * PFNGLPATCHPARAMETERFVPROC) (GLenum pname, const GLfloat* values);
+typedef void (GLAPIENTRY * PFNGLPATCHPARAMETERIPROC) (GLenum pname, GLint value);
+#define glPatchParameterfv GLEW_GET_FUN(__glewPatchParameterfv)
+#define glPatchParameteri GLEW_GET_FUN(__glewPatchParameteri)
+#define GLEW_ARB_tessellation_shader GLEW_GET_VAR(__GLEW_ARB_tessellation_shader)
+#endif /* GL_ARB_tessellation_shader */
+/* ------------------------- GL_ARB_texture_barrier ------------------------ */
+#ifndef GL_ARB_texture_barrier
+#define GL_ARB_texture_barrier 1
+#define glTextureBarrier GLEW_GET_FUN(__glewTextureBarrier)
+#define GLEW_ARB_texture_barrier GLEW_GET_VAR(__GLEW_ARB_texture_barrier)
+#endif /* GL_ARB_texture_barrier */
+/* ---------------------- GL_ARB_texture_border_clamp ---------------------- */
+#ifndef GL_ARB_texture_border_clamp
+#define GL_ARB_texture_border_clamp 1
+#define GL_CLAMP_TO_BORDER_ARB 0x812D
+#define GLEW_ARB_texture_border_clamp GLEW_GET_VAR(__GLEW_ARB_texture_border_clamp)
+#endif /* GL_ARB_texture_border_clamp */
+/* ---------------------- GL_ARB_texture_buffer_object --------------------- */
+#ifndef GL_ARB_texture_buffer_object
+#define GL_ARB_texture_buffer_object 1
+typedef void (GLAPIENTRY * PFNGLTEXBUFFERARBPROC) (GLenum target, GLenum internalformat, GLuint buffer);
+#define glTexBufferARB GLEW_GET_FUN(__glewTexBufferARB)
+#define GLEW_ARB_texture_buffer_object GLEW_GET_VAR(__GLEW_ARB_texture_buffer_object)
+#endif /* GL_ARB_texture_buffer_object */
+/* ------------------- GL_ARB_texture_buffer_object_rgb32 ------------------ */
+#ifndef GL_ARB_texture_buffer_object_rgb32
+#define GL_ARB_texture_buffer_object_rgb32 1
+#define GLEW_ARB_texture_buffer_object_rgb32 GLEW_GET_VAR(__GLEW_ARB_texture_buffer_object_rgb32)
+#endif /* GL_ARB_texture_buffer_object_rgb32 */
+/* ---------------------- GL_ARB_texture_buffer_range ---------------------- */
+#ifndef GL_ARB_texture_buffer_range
+#define GL_ARB_texture_buffer_range 1
+typedef void (GLAPIENTRY * PFNGLTEXBUFFERRANGEPROC) (GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size);
+typedef void (GLAPIENTRY * PFNGLTEXTUREBUFFERRANGEEXTPROC) (GLuint texture, GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size);
+#define glTexBufferRange GLEW_GET_FUN(__glewTexBufferRange)
+#define glTextureBufferRangeEXT GLEW_GET_FUN(__glewTextureBufferRangeEXT)
+#define GLEW_ARB_texture_buffer_range GLEW_GET_VAR(__GLEW_ARB_texture_buffer_range)
+#endif /* GL_ARB_texture_buffer_range */
+/* ----------------------- GL_ARB_texture_compression ---------------------- */
+#ifndef GL_ARB_texture_compression
+#define GL_ARB_texture_compression 1
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint lod, void *img);
+#define glCompressedTexImage1DARB GLEW_GET_FUN(__glewCompressedTexImage1DARB)
+#define glCompressedTexImage2DARB GLEW_GET_FUN(__glewCompressedTexImage2DARB)
+#define glCompressedTexImage3DARB GLEW_GET_FUN(__glewCompressedTexImage3DARB)
+#define glCompressedTexSubImage1DARB GLEW_GET_FUN(__glewCompressedTexSubImage1DARB)
+#define glCompressedTexSubImage2DARB GLEW_GET_FUN(__glewCompressedTexSubImage2DARB)
+#define glCompressedTexSubImage3DARB GLEW_GET_FUN(__glewCompressedTexSubImage3DARB)
+#define glGetCompressedTexImageARB GLEW_GET_FUN(__glewGetCompressedTexImageARB)
+#define GLEW_ARB_texture_compression GLEW_GET_VAR(__GLEW_ARB_texture_compression)
+#endif /* GL_ARB_texture_compression */
+/* -------------------- GL_ARB_texture_compression_bptc -------------------- */
+#ifndef GL_ARB_texture_compression_bptc
+#define GL_ARB_texture_compression_bptc 1
+#define GLEW_ARB_texture_compression_bptc GLEW_GET_VAR(__GLEW_ARB_texture_compression_bptc)
+#endif /* GL_ARB_texture_compression_bptc */
+/* -------------------- GL_ARB_texture_compression_rgtc -------------------- */
+#ifndef GL_ARB_texture_compression_rgtc
+#define GL_ARB_texture_compression_rgtc 1
+#define GLEW_ARB_texture_compression_rgtc GLEW_GET_VAR(__GLEW_ARB_texture_compression_rgtc)
+#endif /* GL_ARB_texture_compression_rgtc */
+/* ------------------------ GL_ARB_texture_cube_map ------------------------ */
+#ifndef GL_ARB_texture_cube_map
+#define GL_ARB_texture_cube_map 1
+#define GL_NORMAL_MAP_ARB 0x8511
+#define GL_REFLECTION_MAP_ARB 0x8512
+#define GL_TEXTURE_CUBE_MAP_ARB 0x8513
+#define GLEW_ARB_texture_cube_map GLEW_GET_VAR(__GLEW_ARB_texture_cube_map)
+#endif /* GL_ARB_texture_cube_map */
+/* --------------------- GL_ARB_texture_cube_map_array --------------------- */
+#ifndef GL_ARB_texture_cube_map_array
+#define GL_ARB_texture_cube_map_array 1
+#define GLEW_ARB_texture_cube_map_array GLEW_GET_VAR(__GLEW_ARB_texture_cube_map_array)
+#endif /* GL_ARB_texture_cube_map_array */
+/* ------------------------- GL_ARB_texture_env_add ------------------------ */
+#ifndef GL_ARB_texture_env_add
+#define GL_ARB_texture_env_add 1
+#define GLEW_ARB_texture_env_add GLEW_GET_VAR(__GLEW_ARB_texture_env_add)
+#endif /* GL_ARB_texture_env_add */
+/* ----------------------- GL_ARB_texture_env_combine ---------------------- */
+#ifndef GL_ARB_texture_env_combine
+#define GL_ARB_texture_env_combine 1
+#define GL_SUBTRACT_ARB 0x84E7
+#define GL_COMBINE_ARB 0x8570
+#define GL_COMBINE_RGB_ARB 0x8571
+#define GL_COMBINE_ALPHA_ARB 0x8572
+#define GL_RGB_SCALE_ARB 0x8573
+#define GL_ADD_SIGNED_ARB 0x8574
+#define GL_INTERPOLATE_ARB 0x8575
+#define GL_CONSTANT_ARB 0x8576
+#define GL_PRIMARY_COLOR_ARB 0x8577
+#define GL_PREVIOUS_ARB 0x8578
+#define GL_SOURCE0_RGB_ARB 0x8580
+#define GL_SOURCE1_RGB_ARB 0x8581
+#define GL_SOURCE2_RGB_ARB 0x8582
+#define GL_SOURCE0_ALPHA_ARB 0x8588
+#define GL_SOURCE1_ALPHA_ARB 0x8589
+#define GL_SOURCE2_ALPHA_ARB 0x858A
+#define GL_OPERAND0_RGB_ARB 0x8590
+#define GL_OPERAND1_RGB_ARB 0x8591
+#define GL_OPERAND2_RGB_ARB 0x8592
+#define GL_OPERAND0_ALPHA_ARB 0x8598
+#define GL_OPERAND1_ALPHA_ARB 0x8599
+#define GL_OPERAND2_ALPHA_ARB 0x859A
+#define GLEW_ARB_texture_env_combine GLEW_GET_VAR(__GLEW_ARB_texture_env_combine)
+#endif /* GL_ARB_texture_env_combine */
+/* ---------------------- GL_ARB_texture_env_crossbar ---------------------- */
+#ifndef GL_ARB_texture_env_crossbar
+#define GL_ARB_texture_env_crossbar 1
+#define GLEW_ARB_texture_env_crossbar GLEW_GET_VAR(__GLEW_ARB_texture_env_crossbar)
+#endif /* GL_ARB_texture_env_crossbar */
+/* ------------------------ GL_ARB_texture_env_dot3 ------------------------ */
+#ifndef GL_ARB_texture_env_dot3
+#define GL_ARB_texture_env_dot3 1
+#define GL_DOT3_RGB_ARB 0x86AE
+#define GL_DOT3_RGBA_ARB 0x86AF
+#define GLEW_ARB_texture_env_dot3 GLEW_GET_VAR(__GLEW_ARB_texture_env_dot3)
+#endif /* GL_ARB_texture_env_dot3 */
+/* ------------------- GL_ARB_texture_filter_anisotropic ------------------- */
+#ifndef GL_ARB_texture_filter_anisotropic
+#define GL_ARB_texture_filter_anisotropic 1
+#define GLEW_ARB_texture_filter_anisotropic GLEW_GET_VAR(__GLEW_ARB_texture_filter_anisotropic)
+#endif /* GL_ARB_texture_filter_anisotropic */
+/* ---------------------- GL_ARB_texture_filter_minmax --------------------- */
+#ifndef GL_ARB_texture_filter_minmax
+#define GL_ARB_texture_filter_minmax 1
+#define GLEW_ARB_texture_filter_minmax GLEW_GET_VAR(__GLEW_ARB_texture_filter_minmax)
+#endif /* GL_ARB_texture_filter_minmax */
+/* -------------------------- GL_ARB_texture_float ------------------------- */
+#ifndef GL_ARB_texture_float
+#define GL_ARB_texture_float 1
+#define GL_RGBA32F_ARB 0x8814
+#define GL_RGB32F_ARB 0x8815
+#define GL_ALPHA32F_ARB 0x8816
+#define GL_INTENSITY32F_ARB 0x8817
+#define GL_LUMINANCE32F_ARB 0x8818
+#define GL_LUMINANCE_ALPHA32F_ARB 0x8819
+#define GL_RGBA16F_ARB 0x881A
+#define GL_RGB16F_ARB 0x881B
+#define GL_ALPHA16F_ARB 0x881C
+#define GL_INTENSITY16F_ARB 0x881D
+#define GL_LUMINANCE16F_ARB 0x881E
+#define GLEW_ARB_texture_float GLEW_GET_VAR(__GLEW_ARB_texture_float)
+#endif /* GL_ARB_texture_float */
+/* ------------------------- GL_ARB_texture_gather ------------------------- */
+#ifndef GL_ARB_texture_gather
+#define GL_ARB_texture_gather 1
+#define GLEW_ARB_texture_gather GLEW_GET_VAR(__GLEW_ARB_texture_gather)
+#endif /* GL_ARB_texture_gather */
+/* ------------------ GL_ARB_texture_mirror_clamp_to_edge ------------------ */
+#ifndef GL_ARB_texture_mirror_clamp_to_edge
+#define GL_ARB_texture_mirror_clamp_to_edge 1
+#define GL_MIRROR_CLAMP_TO_EDGE 0x8743
+#define GLEW_ARB_texture_mirror_clamp_to_edge GLEW_GET_VAR(__GLEW_ARB_texture_mirror_clamp_to_edge)
+#endif /* GL_ARB_texture_mirror_clamp_to_edge */
+/* --------------------- GL_ARB_texture_mirrored_repeat -------------------- */
+#ifndef GL_ARB_texture_mirrored_repeat
+#define GL_ARB_texture_mirrored_repeat 1
+#define GL_MIRRORED_REPEAT_ARB 0x8370
+#define GLEW_ARB_texture_mirrored_repeat GLEW_GET_VAR(__GLEW_ARB_texture_mirrored_repeat)
+#endif /* GL_ARB_texture_mirrored_repeat */
+/* ----------------------- GL_ARB_texture_multisample ---------------------- */
+#ifndef GL_ARB_texture_multisample
+#define GL_ARB_texture_multisample 1
+#define GL_SAMPLE_POSITION 0x8E50
+#define GL_SAMPLE_MASK 0x8E51
+#define GL_SAMPLE_MASK_VALUE 0x8E52
+#define GL_TEXTURE_SAMPLES 0x9106
+#define GL_MAX_INTEGER_SAMPLES 0x9110
+typedef void (GLAPIENTRY * PFNGLGETMULTISAMPLEFVPROC) (GLenum pname, GLuint index, GLfloat* val);
+typedef void (GLAPIENTRY * PFNGLSAMPLEMASKIPROC) (GLuint index, GLbitfield mask);
+typedef void (GLAPIENTRY * PFNGLTEXIMAGE2DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations);
+typedef void (GLAPIENTRY * PFNGLTEXIMAGE3DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations);
+#define glGetMultisamplefv GLEW_GET_FUN(__glewGetMultisamplefv)
+#define glSampleMaski GLEW_GET_FUN(__glewSampleMaski)
+#define glTexImage2DMultisample GLEW_GET_FUN(__glewTexImage2DMultisample)
+#define glTexImage3DMultisample GLEW_GET_FUN(__glewTexImage3DMultisample)
+#define GLEW_ARB_texture_multisample GLEW_GET_VAR(__GLEW_ARB_texture_multisample)
+#endif /* GL_ARB_texture_multisample */
+/* -------------------- GL_ARB_texture_non_power_of_two -------------------- */
+#ifndef GL_ARB_texture_non_power_of_two
+#define GL_ARB_texture_non_power_of_two 1
+#define GLEW_ARB_texture_non_power_of_two GLEW_GET_VAR(__GLEW_ARB_texture_non_power_of_two)
+#endif /* GL_ARB_texture_non_power_of_two */
+/* ---------------------- GL_ARB_texture_query_levels ---------------------- */
+#ifndef GL_ARB_texture_query_levels
+#define GL_ARB_texture_query_levels 1
+#define GLEW_ARB_texture_query_levels GLEW_GET_VAR(__GLEW_ARB_texture_query_levels)
+#endif /* GL_ARB_texture_query_levels */
+/* ------------------------ GL_ARB_texture_query_lod ----------------------- */
+#ifndef GL_ARB_texture_query_lod
+#define GL_ARB_texture_query_lod 1
+#define GLEW_ARB_texture_query_lod GLEW_GET_VAR(__GLEW_ARB_texture_query_lod)
+#endif /* GL_ARB_texture_query_lod */
+/* ------------------------ GL_ARB_texture_rectangle ----------------------- */
+#ifndef GL_ARB_texture_rectangle
+#define GL_ARB_texture_rectangle 1
+#define GL_SAMPLER_2D_RECT_ARB 0x8B63
+#define GLEW_ARB_texture_rectangle GLEW_GET_VAR(__GLEW_ARB_texture_rectangle)
+#endif /* GL_ARB_texture_rectangle */
+/* --------------------------- GL_ARB_texture_rg --------------------------- */
+#ifndef GL_ARB_texture_rg
+#define GL_ARB_texture_rg 1
+#define GL_COMPRESSED_RED 0x8225
+#define GL_COMPRESSED_RG 0x8226
+#define GL_RG 0x8227
+#define GL_RG_INTEGER 0x8228
+#define GL_R8 0x8229
+#define GL_R16 0x822A
+#define GL_RG8 0x822B
+#define GL_RG16 0x822C
+#define GL_R16F 0x822D
+#define GL_R32F 0x822E
+#define GL_RG16F 0x822F
+#define GL_RG32F 0x8230
+#define GL_R8I 0x8231
+#define GL_R8UI 0x8232
+#define GL_R16I 0x8233
+#define GL_R16UI 0x8234
+#define GL_R32I 0x8235
+#define GL_R32UI 0x8236
+#define GL_RG8I 0x8237
+#define GL_RG8UI 0x8238
+#define GL_RG16I 0x8239
+#define GL_RG16UI 0x823A
+#define GL_RG32I 0x823B
+#define GL_RG32UI 0x823C
+#define GLEW_ARB_texture_rg GLEW_GET_VAR(__GLEW_ARB_texture_rg)
+#endif /* GL_ARB_texture_rg */
+/* ----------------------- GL_ARB_texture_rgb10_a2ui ----------------------- */
+#ifndef GL_ARB_texture_rgb10_a2ui
+#define GL_ARB_texture_rgb10_a2ui 1
+#define GL_RGB10_A2UI 0x906F
+#define GLEW_ARB_texture_rgb10_a2ui GLEW_GET_VAR(__GLEW_ARB_texture_rgb10_a2ui)
+#endif /* GL_ARB_texture_rgb10_a2ui */
+/* ------------------------ GL_ARB_texture_stencil8 ------------------------ */
+#ifndef GL_ARB_texture_stencil8
+#define GL_ARB_texture_stencil8 1
+#define GL_STENCIL_INDEX 0x1901
+#define GL_STENCIL_INDEX8 0x8D48
+#define GLEW_ARB_texture_stencil8 GLEW_GET_VAR(__GLEW_ARB_texture_stencil8)
+#endif /* GL_ARB_texture_stencil8 */
+/* ------------------------- GL_ARB_texture_storage ------------------------ */
+#ifndef GL_ARB_texture_storage
+#define GL_ARB_texture_storage 1
+typedef void (GLAPIENTRY * PFNGLTEXSTORAGE1DPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLTEXSTORAGE2DPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLTEXSTORAGE3DPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth);
+#define glTexStorage1D GLEW_GET_FUN(__glewTexStorage1D)
+#define glTexStorage2D GLEW_GET_FUN(__glewTexStorage2D)
+#define glTexStorage3D GLEW_GET_FUN(__glewTexStorage3D)
+#define GLEW_ARB_texture_storage GLEW_GET_VAR(__GLEW_ARB_texture_storage)
+#endif /* GL_ARB_texture_storage */
+/* ------------------- GL_ARB_texture_storage_multisample ------------------ */
+#ifndef GL_ARB_texture_storage_multisample
+#define GL_ARB_texture_storage_multisample 1
+typedef void (GLAPIENTRY * PFNGLTEXSTORAGE2DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations);
+typedef void (GLAPIENTRY * PFNGLTEXSTORAGE3DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations);
+typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE2DMULTISAMPLEEXTPROC) (GLuint texture, GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations);
+typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE3DMULTISAMPLEEXTPROC) (GLuint texture, GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations);
+#define glTexStorage2DMultisample GLEW_GET_FUN(__glewTexStorage2DMultisample)
+#define glTexStorage3DMultisample GLEW_GET_FUN(__glewTexStorage3DMultisample)
+#define glTextureStorage2DMultisampleEXT GLEW_GET_FUN(__glewTextureStorage2DMultisampleEXT)
+#define glTextureStorage3DMultisampleEXT GLEW_GET_FUN(__glewTextureStorage3DMultisampleEXT)
+#define GLEW_ARB_texture_storage_multisample GLEW_GET_VAR(__GLEW_ARB_texture_storage_multisample)
+#endif /* GL_ARB_texture_storage_multisample */
+/* ------------------------- GL_ARB_texture_swizzle ------------------------ */
+#ifndef GL_ARB_texture_swizzle
+#define GL_ARB_texture_swizzle 1
+#define GL_TEXTURE_SWIZZLE_R 0x8E42
+#define GL_TEXTURE_SWIZZLE_G 0x8E43
+#define GL_TEXTURE_SWIZZLE_B 0x8E44
+#define GL_TEXTURE_SWIZZLE_A 0x8E45
+#define GLEW_ARB_texture_swizzle GLEW_GET_VAR(__GLEW_ARB_texture_swizzle)
+#endif /* GL_ARB_texture_swizzle */
+/* -------------------------- GL_ARB_texture_view -------------------------- */
+#ifndef GL_ARB_texture_view
+#define GL_ARB_texture_view 1
+typedef void (GLAPIENTRY * PFNGLTEXTUREVIEWPROC) (GLuint texture, GLenum target, GLuint origtexture, GLenum internalformat, GLuint minlevel, GLuint numlevels, GLuint minlayer, GLuint numlayers);
+#define glTextureView GLEW_GET_FUN(__glewTextureView)
+#define GLEW_ARB_texture_view GLEW_GET_VAR(__GLEW_ARB_texture_view)
+#endif /* GL_ARB_texture_view */
+/* --------------------------- GL_ARB_timer_query -------------------------- */
+#ifndef GL_ARB_timer_query
+#define GL_ARB_timer_query 1
+#define GL_TIME_ELAPSED 0x88BF
+#define GL_TIMESTAMP 0x8E28
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTI64VPROC) (GLuint id, GLenum pname, GLint64* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTUI64VPROC) (GLuint id, GLenum pname, GLuint64* params);
+typedef void (GLAPIENTRY * PFNGLQUERYCOUNTERPROC) (GLuint id, GLenum target);
+#define glGetQueryObjecti64v GLEW_GET_FUN(__glewGetQueryObjecti64v)
+#define glGetQueryObjectui64v GLEW_GET_FUN(__glewGetQueryObjectui64v)
+#define glQueryCounter GLEW_GET_FUN(__glewQueryCounter)
+#define GLEW_ARB_timer_query GLEW_GET_VAR(__GLEW_ARB_timer_query)
+#endif /* GL_ARB_timer_query */
+/* ----------------------- GL_ARB_transform_feedback2 ---------------------- */
+#ifndef GL_ARB_transform_feedback2
+#define GL_ARB_transform_feedback2 1
+typedef void (GLAPIENTRY * PFNGLDELETETRANSFORMFEEDBACKSPROC) (GLsizei n, const GLuint* ids);
+#define glBindTransformFeedback GLEW_GET_FUN(__glewBindTransformFeedback)
+#define glDeleteTransformFeedbacks GLEW_GET_FUN(__glewDeleteTransformFeedbacks)
+#define glDrawTransformFeedback GLEW_GET_FUN(__glewDrawTransformFeedback)
+#define glGenTransformFeedbacks GLEW_GET_FUN(__glewGenTransformFeedbacks)
+#define glIsTransformFeedback GLEW_GET_FUN(__glewIsTransformFeedback)
+#define glPauseTransformFeedback GLEW_GET_FUN(__glewPauseTransformFeedback)
+#define glResumeTransformFeedback GLEW_GET_FUN(__glewResumeTransformFeedback)
+#define GLEW_ARB_transform_feedback2 GLEW_GET_VAR(__GLEW_ARB_transform_feedback2)
+#endif /* GL_ARB_transform_feedback2 */
+/* ----------------------- GL_ARB_transform_feedback3 ---------------------- */
+#ifndef GL_ARB_transform_feedback3
+#define GL_ARB_transform_feedback3 1
+typedef void (GLAPIENTRY * PFNGLBEGINQUERYINDEXEDPROC) (GLenum target, GLuint index, GLuint id);
+typedef void (GLAPIENTRY * PFNGLDRAWTRANSFORMFEEDBACKSTREAMPROC) (GLenum mode, GLuint id, GLuint stream);
+typedef void (GLAPIENTRY * PFNGLENDQUERYINDEXEDPROC) (GLenum target, GLuint index);
+typedef void (GLAPIENTRY * PFNGLGETQUERYINDEXEDIVPROC) (GLenum target, GLuint index, GLenum pname, GLint* params);
+#define glBeginQueryIndexed GLEW_GET_FUN(__glewBeginQueryIndexed)
+#define glDrawTransformFeedbackStream GLEW_GET_FUN(__glewDrawTransformFeedbackStream)
+#define glEndQueryIndexed GLEW_GET_FUN(__glewEndQueryIndexed)
+#define glGetQueryIndexediv GLEW_GET_FUN(__glewGetQueryIndexediv)
+#define GLEW_ARB_transform_feedback3 GLEW_GET_VAR(__GLEW_ARB_transform_feedback3)
+#endif /* GL_ARB_transform_feedback3 */
+/* ------------------ GL_ARB_transform_feedback_instanced ------------------ */
+#ifndef GL_ARB_transform_feedback_instanced
+#define GL_ARB_transform_feedback_instanced 1
+typedef void (GLAPIENTRY * PFNGLDRAWTRANSFORMFEEDBACKINSTANCEDPROC) (GLenum mode, GLuint id, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLDRAWTRANSFORMFEEDBACKSTREAMINSTANCEDPROC) (GLenum mode, GLuint id, GLuint stream, GLsizei primcount);
+#define glDrawTransformFeedbackInstanced GLEW_GET_FUN(__glewDrawTransformFeedbackInstanced)
+#define glDrawTransformFeedbackStreamInstanced GLEW_GET_FUN(__glewDrawTransformFeedbackStreamInstanced)
+#define GLEW_ARB_transform_feedback_instanced GLEW_GET_VAR(__GLEW_ARB_transform_feedback_instanced)
+#endif /* GL_ARB_transform_feedback_instanced */
+/* ---------------- GL_ARB_transform_feedback_overflow_query --------------- */
+#ifndef GL_ARB_transform_feedback_overflow_query
+#define GL_ARB_transform_feedback_overflow_query 1
+#define GLEW_ARB_transform_feedback_overflow_query GLEW_GET_VAR(__GLEW_ARB_transform_feedback_overflow_query)
+#endif /* GL_ARB_transform_feedback_overflow_query */
+/* ------------------------ GL_ARB_transpose_matrix ------------------------ */
+#ifndef GL_ARB_transpose_matrix
+#define GL_ARB_transpose_matrix 1
+#define glLoadTransposeMatrixdARB GLEW_GET_FUN(__glewLoadTransposeMatrixdARB)
+#define glLoadTransposeMatrixfARB GLEW_GET_FUN(__glewLoadTransposeMatrixfARB)
+#define glMultTransposeMatrixdARB GLEW_GET_FUN(__glewMultTransposeMatrixdARB)
+#define glMultTransposeMatrixfARB GLEW_GET_FUN(__glewMultTransposeMatrixfARB)
+#define GLEW_ARB_transpose_matrix GLEW_GET_VAR(__GLEW_ARB_transpose_matrix)
+#endif /* GL_ARB_transpose_matrix */
+/* ---------------------- GL_ARB_uniform_buffer_object --------------------- */
+#ifndef GL_ARB_uniform_buffer_object
+#define GL_ARB_uniform_buffer_object 1
+#define GL_UNIFORM_BUFFER 0x8A11
+#define GL_UNIFORM_TYPE 0x8A37
+#define GL_UNIFORM_SIZE 0x8A38
+typedef void (GLAPIENTRY * PFNGLBINDBUFFERBASEPROC) (GLenum target, GLuint index, GLuint buffer);
+typedef void (GLAPIENTRY * PFNGLBINDBUFFERRANGEPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size);
+typedef void (GLAPIENTRY * PFNGLGETACTIVEUNIFORMBLOCKNAMEPROC) (GLuint program, GLuint uniformBlockIndex, GLsizei bufSize, GLsizei* length, GLchar* uniformBlockName);
+typedef void (GLAPIENTRY * PFNGLGETACTIVEUNIFORMBLOCKIVPROC) (GLuint program, GLuint uniformBlockIndex, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETACTIVEUNIFORMNAMEPROC) (GLuint program, GLuint uniformIndex, GLsizei bufSize, GLsizei* length, GLchar* uniformName);
+typedef void (GLAPIENTRY * PFNGLGETACTIVEUNIFORMSIVPROC) (GLuint program, GLsizei uniformCount, const GLuint* uniformIndices, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETINTEGERI_VPROC) (GLenum target, GLuint index, GLint* data);
+typedef GLuint (GLAPIENTRY * PFNGLGETUNIFORMBLOCKINDEXPROC) (GLuint program, const GLchar* uniformBlockName);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMINDICESPROC) (GLuint program, GLsizei uniformCount, const GLchar* const * uniformNames, GLuint* uniformIndices);
+typedef void (GLAPIENTRY * PFNGLUNIFORMBLOCKBINDINGPROC) (GLuint program, GLuint uniformBlockIndex, GLuint uniformBlockBinding);
+#define glBindBufferBase GLEW_GET_FUN(__glewBindBufferBase)
+#define glBindBufferRange GLEW_GET_FUN(__glewBindBufferRange)
+#define glGetActiveUniformBlockName GLEW_GET_FUN(__glewGetActiveUniformBlockName)
+#define glGetActiveUniformBlockiv GLEW_GET_FUN(__glewGetActiveUniformBlockiv)
+#define glGetActiveUniformName GLEW_GET_FUN(__glewGetActiveUniformName)
+#define glGetActiveUniformsiv GLEW_GET_FUN(__glewGetActiveUniformsiv)
+#define glGetIntegeri_v GLEW_GET_FUN(__glewGetIntegeri_v)
+#define glGetUniformBlockIndex GLEW_GET_FUN(__glewGetUniformBlockIndex)
+#define glGetUniformIndices GLEW_GET_FUN(__glewGetUniformIndices)
+#define glUniformBlockBinding GLEW_GET_FUN(__glewUniformBlockBinding)
+#define GLEW_ARB_uniform_buffer_object GLEW_GET_VAR(__GLEW_ARB_uniform_buffer_object)
+#endif /* GL_ARB_uniform_buffer_object */
+/* ------------------------ GL_ARB_vertex_array_bgra ----------------------- */
+#ifndef GL_ARB_vertex_array_bgra
+#define GL_ARB_vertex_array_bgra 1
+#define GL_BGRA 0x80E1
+#define GLEW_ARB_vertex_array_bgra GLEW_GET_VAR(__GLEW_ARB_vertex_array_bgra)
+#endif /* GL_ARB_vertex_array_bgra */
+/* ----------------------- GL_ARB_vertex_array_object ---------------------- */
+#ifndef GL_ARB_vertex_array_object
+#define GL_ARB_vertex_array_object 1
+typedef void (GLAPIENTRY * PFNGLDELETEVERTEXARRAYSPROC) (GLsizei n, const GLuint* arrays);
+typedef void (GLAPIENTRY * PFNGLGENVERTEXARRAYSPROC) (GLsizei n, GLuint* arrays);
+typedef GLboolean (GLAPIENTRY * PFNGLISVERTEXARRAYPROC) (GLuint array);
+#define glBindVertexArray GLEW_GET_FUN(__glewBindVertexArray)
+#define glDeleteVertexArrays GLEW_GET_FUN(__glewDeleteVertexArrays)
+#define glGenVertexArrays GLEW_GET_FUN(__glewGenVertexArrays)
+#define glIsVertexArray GLEW_GET_FUN(__glewIsVertexArray)
+#define GLEW_ARB_vertex_array_object GLEW_GET_VAR(__GLEW_ARB_vertex_array_object)
+#endif /* GL_ARB_vertex_array_object */
+/* ----------------------- GL_ARB_vertex_attrib_64bit ---------------------- */
+#ifndef GL_ARB_vertex_attrib_64bit
+#define GL_ARB_vertex_attrib_64bit 1
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBLDVPROC) (GLuint index, GLenum pname, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBL1DPROC) (GLuint index, GLdouble x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBL1DVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBL2DPROC) (GLuint index, GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBL2DVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBL3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBL3DVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBL4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBL4DVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBLPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void* pointer);
+#define glGetVertexAttribLdv GLEW_GET_FUN(__glewGetVertexAttribLdv)
+#define glVertexAttribL1d GLEW_GET_FUN(__glewVertexAttribL1d)
+#define glVertexAttribL1dv GLEW_GET_FUN(__glewVertexAttribL1dv)
+#define glVertexAttribL2d GLEW_GET_FUN(__glewVertexAttribL2d)
+#define glVertexAttribL2dv GLEW_GET_FUN(__glewVertexAttribL2dv)
+#define glVertexAttribL3d GLEW_GET_FUN(__glewVertexAttribL3d)
+#define glVertexAttribL3dv GLEW_GET_FUN(__glewVertexAttribL3dv)
+#define glVertexAttribL4d GLEW_GET_FUN(__glewVertexAttribL4d)
+#define glVertexAttribL4dv GLEW_GET_FUN(__glewVertexAttribL4dv)
+#define glVertexAttribLPointer GLEW_GET_FUN(__glewVertexAttribLPointer)
+#define GLEW_ARB_vertex_attrib_64bit GLEW_GET_VAR(__GLEW_ARB_vertex_attrib_64bit)
+#endif /* GL_ARB_vertex_attrib_64bit */
+/* ---------------------- GL_ARB_vertex_attrib_binding --------------------- */
+#ifndef GL_ARB_vertex_attrib_binding
+#define GL_ARB_vertex_attrib_binding 1
+typedef void (GLAPIENTRY * PFNGLBINDVERTEXBUFFERPROC) (GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYBINDVERTEXBUFFEREXTPROC) (GLuint vaobj, GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXATTRIBBINDINGEXTPROC) (GLuint vaobj, GLuint attribindex, GLuint bindingindex);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXATTRIBFORMATEXTPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXATTRIBIFORMATEXTPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXATTRIBLFORMATEXTPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXBINDINGDIVISOREXTPROC) (GLuint vaobj, GLuint bindingindex, GLuint divisor);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBBINDINGPROC) (GLuint attribindex, GLuint bindingindex);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBFORMATPROC) (GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBIFORMATPROC) (GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBLFORMATPROC) (GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset);
+typedef void (GLAPIENTRY * PFNGLVERTEXBINDINGDIVISORPROC) (GLuint bindingindex, GLuint divisor);
+#define glBindVertexBuffer GLEW_GET_FUN(__glewBindVertexBuffer)
+#define glVertexArrayBindVertexBufferEXT GLEW_GET_FUN(__glewVertexArrayBindVertexBufferEXT)
+#define glVertexArrayVertexAttribBindingEXT GLEW_GET_FUN(__glewVertexArrayVertexAttribBindingEXT)
+#define glVertexArrayVertexAttribFormatEXT GLEW_GET_FUN(__glewVertexArrayVertexAttribFormatEXT)
+#define glVertexArrayVertexAttribIFormatEXT GLEW_GET_FUN(__glewVertexArrayVertexAttribIFormatEXT)
+#define glVertexArrayVertexAttribLFormatEXT GLEW_GET_FUN(__glewVertexArrayVertexAttribLFormatEXT)
+#define glVertexArrayVertexBindingDivisorEXT GLEW_GET_FUN(__glewVertexArrayVertexBindingDivisorEXT)
+#define glVertexAttribBinding GLEW_GET_FUN(__glewVertexAttribBinding)
+#define glVertexAttribFormat GLEW_GET_FUN(__glewVertexAttribFormat)
+#define glVertexAttribIFormat GLEW_GET_FUN(__glewVertexAttribIFormat)
+#define glVertexAttribLFormat GLEW_GET_FUN(__glewVertexAttribLFormat)
+#define glVertexBindingDivisor GLEW_GET_FUN(__glewVertexBindingDivisor)
+#define GLEW_ARB_vertex_attrib_binding GLEW_GET_VAR(__GLEW_ARB_vertex_attrib_binding)
+#endif /* GL_ARB_vertex_attrib_binding */
+/* -------------------------- GL_ARB_vertex_blend -------------------------- */
+#ifndef GL_ARB_vertex_blend
+#define GL_ARB_vertex_blend 1
+#define GL_MODELVIEW0_ARB 0x1700
+#define GL_MODELVIEW1_ARB 0x850A
+#define GL_VERTEX_BLEND_ARB 0x86A7
+#define GL_MODELVIEW2_ARB 0x8722
+#define GL_MODELVIEW3_ARB 0x8723
+#define GL_MODELVIEW4_ARB 0x8724
+#define GL_MODELVIEW5_ARB 0x8725
+#define GL_MODELVIEW6_ARB 0x8726
+#define GL_MODELVIEW7_ARB 0x8727
+#define GL_MODELVIEW8_ARB 0x8728
+#define GL_MODELVIEW9_ARB 0x8729
+#define GL_MODELVIEW10_ARB 0x872A
+#define GL_MODELVIEW11_ARB 0x872B
+#define GL_MODELVIEW12_ARB 0x872C
+#define GL_MODELVIEW13_ARB 0x872D
+#define GL_MODELVIEW14_ARB 0x872E
+#define GL_MODELVIEW15_ARB 0x872F
+#define GL_MODELVIEW16_ARB 0x8730
+#define GL_MODELVIEW17_ARB 0x8731
+#define GL_MODELVIEW18_ARB 0x8732
+#define GL_MODELVIEW19_ARB 0x8733
+#define GL_MODELVIEW20_ARB 0x8734
+#define GL_MODELVIEW21_ARB 0x8735
+#define GL_MODELVIEW22_ARB 0x8736
+#define GL_MODELVIEW23_ARB 0x8737
+#define GL_MODELVIEW24_ARB 0x8738
+#define GL_MODELVIEW25_ARB 0x8739
+#define GL_MODELVIEW26_ARB 0x873A
+#define GL_MODELVIEW27_ARB 0x873B
+#define GL_MODELVIEW28_ARB 0x873C
+#define GL_MODELVIEW29_ARB 0x873D
+#define GL_MODELVIEW30_ARB 0x873E
+#define GL_MODELVIEW31_ARB 0x873F
+typedef void (GLAPIENTRY * PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, void *pointer);
+typedef void (GLAPIENTRY * PFNGLWEIGHTBVARBPROC) (GLint size, GLbyte *weights);
+typedef void (GLAPIENTRY * PFNGLWEIGHTDVARBPROC) (GLint size, GLdouble *weights);
+typedef void (GLAPIENTRY * PFNGLWEIGHTFVARBPROC) (GLint size, GLfloat *weights);
+typedef void (GLAPIENTRY * PFNGLWEIGHTIVARBPROC) (GLint size, GLint *weights);
+typedef void (GLAPIENTRY * PFNGLWEIGHTSVARBPROC) (GLint size, GLshort *weights);
+typedef void (GLAPIENTRY * PFNGLWEIGHTUBVARBPROC) (GLint size, GLubyte *weights);
+typedef void (GLAPIENTRY * PFNGLWEIGHTUIVARBPROC) (GLint size, GLuint *weights);
+typedef void (GLAPIENTRY * PFNGLWEIGHTUSVARBPROC) (GLint size, GLushort *weights);
+#define glVertexBlendARB GLEW_GET_FUN(__glewVertexBlendARB)
+#define glWeightPointerARB GLEW_GET_FUN(__glewWeightPointerARB)
+#define glWeightbvARB GLEW_GET_FUN(__glewWeightbvARB)
+#define glWeightdvARB GLEW_GET_FUN(__glewWeightdvARB)
+#define glWeightfvARB GLEW_GET_FUN(__glewWeightfvARB)
+#define glWeightivARB GLEW_GET_FUN(__glewWeightivARB)
+#define glWeightsvARB GLEW_GET_FUN(__glewWeightsvARB)
+#define glWeightubvARB GLEW_GET_FUN(__glewWeightubvARB)
+#define glWeightuivARB GLEW_GET_FUN(__glewWeightuivARB)
+#define glWeightusvARB GLEW_GET_FUN(__glewWeightusvARB)
+#define GLEW_ARB_vertex_blend GLEW_GET_VAR(__GLEW_ARB_vertex_blend)
+#endif /* GL_ARB_vertex_blend */
+/* ---------------------- GL_ARB_vertex_buffer_object ---------------------- */
+#ifndef GL_ARB_vertex_buffer_object
+#define GL_ARB_vertex_buffer_object 1
+#define GL_BUFFER_SIZE_ARB 0x8764
+#define GL_BUFFER_USAGE_ARB 0x8765
+#define GL_ARRAY_BUFFER_ARB 0x8892
+#define GL_READ_ONLY_ARB 0x88B8
+#define GL_WRITE_ONLY_ARB 0x88B9
+#define GL_READ_WRITE_ARB 0x88BA
+#define GL_STREAM_DRAW_ARB 0x88E0
+#define GL_STREAM_READ_ARB 0x88E1
+#define GL_STREAM_COPY_ARB 0x88E2
+#define GL_STATIC_DRAW_ARB 0x88E4
+#define GL_STATIC_READ_ARB 0x88E5
+#define GL_STATIC_COPY_ARB 0x88E6
+#define GL_DYNAMIC_DRAW_ARB 0x88E8
+#define GL_DYNAMIC_READ_ARB 0x88E9
+typedef ptrdiff_t GLintptrARB;
+typedef ptrdiff_t GLsizeiptrARB;
+typedef void (GLAPIENTRY * PFNGLBINDBUFFERARBPROC) (GLenum target, GLuint buffer);
+typedef void (GLAPIENTRY * PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const void *data, GLenum usage);
+typedef void (GLAPIENTRY * PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const void *data);
+typedef void (GLAPIENTRY * PFNGLDELETEBUFFERSARBPROC) (GLsizei n, const GLuint* buffers);
+typedef void (GLAPIENTRY * PFNGLGENBUFFERSARBPROC) (GLsizei n, GLuint* buffers);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERPARAMETERIVARBPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, void** params);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, void *data);
+typedef GLboolean (GLAPIENTRY * PFNGLISBUFFERARBPROC) (GLuint buffer);
+typedef void * (GLAPIENTRY * PFNGLMAPBUFFERARBPROC) (GLenum target, GLenum access);
+typedef GLboolean (GLAPIENTRY * PFNGLUNMAPBUFFERARBPROC) (GLenum target);
+#define glBindBufferARB GLEW_GET_FUN(__glewBindBufferARB)
+#define glBufferDataARB GLEW_GET_FUN(__glewBufferDataARB)
+#define glBufferSubDataARB GLEW_GET_FUN(__glewBufferSubDataARB)
+#define glDeleteBuffersARB GLEW_GET_FUN(__glewDeleteBuffersARB)
+#define glGenBuffersARB GLEW_GET_FUN(__glewGenBuffersARB)
+#define glGetBufferParameterivARB GLEW_GET_FUN(__glewGetBufferParameterivARB)
+#define glGetBufferPointervARB GLEW_GET_FUN(__glewGetBufferPointervARB)
+#define glGetBufferSubDataARB GLEW_GET_FUN(__glewGetBufferSubDataARB)
+#define glIsBufferARB GLEW_GET_FUN(__glewIsBufferARB)
+#define glMapBufferARB GLEW_GET_FUN(__glewMapBufferARB)
+#define glUnmapBufferARB GLEW_GET_FUN(__glewUnmapBufferARB)
+#define GLEW_ARB_vertex_buffer_object GLEW_GET_VAR(__GLEW_ARB_vertex_buffer_object)
+#endif /* GL_ARB_vertex_buffer_object */
+/* ------------------------- GL_ARB_vertex_program ------------------------- */
+#ifndef GL_ARB_vertex_program
+#define GL_ARB_vertex_program 1
+#define GL_COLOR_SUM_ARB 0x8458
+#define GL_VERTEX_PROGRAM_ARB 0x8620
+#define GL_PROGRAM_LENGTH_ARB 0x8627
+#define GL_PROGRAM_STRING_ARB 0x8628
+#define GL_CURRENT_MATRIX_ARB 0x8641
+#define GL_PROGRAM_BINDING_ARB 0x8677
+#define GL_PROGRAM_FORMAT_ARB 0x8876
+#define GL_MATRIX0_ARB 0x88C0
+#define GL_MATRIX1_ARB 0x88C1
+#define GL_MATRIX2_ARB 0x88C2
+#define GL_MATRIX3_ARB 0x88C3
+#define GL_MATRIX4_ARB 0x88C4
+#define GL_MATRIX5_ARB 0x88C5
+#define GL_MATRIX6_ARB 0x88C6
+#define GL_MATRIX7_ARB 0x88C7
+#define GL_MATRIX8_ARB 0x88C8
+#define GL_MATRIX9_ARB 0x88C9
+#define GL_MATRIX10_ARB 0x88CA
+#define GL_MATRIX11_ARB 0x88CB
+#define GL_MATRIX12_ARB 0x88CC
+#define GL_MATRIX13_ARB 0x88CD
+#define GL_MATRIX14_ARB 0x88CE
+#define GL_MATRIX15_ARB 0x88CF
+#define GL_MATRIX16_ARB 0x88D0
+#define GL_MATRIX17_ARB 0x88D1
+#define GL_MATRIX18_ARB 0x88D2
+#define GL_MATRIX19_ARB 0x88D3
+#define GL_MATRIX20_ARB 0x88D4
+#define GL_MATRIX21_ARB 0x88D5
+#define GL_MATRIX22_ARB 0x88D6
+#define GL_MATRIX23_ARB 0x88D7
+#define GL_MATRIX24_ARB 0x88D8
+#define GL_MATRIX25_ARB 0x88D9
+#define GL_MATRIX26_ARB 0x88DA
+#define GL_MATRIX27_ARB 0x88DB
+#define GL_MATRIX28_ARB 0x88DC
+#define GL_MATRIX29_ARB 0x88DD
+#define GL_MATRIX30_ARB 0x88DE
+#define GL_MATRIX31_ARB 0x88DF
+typedef void (GLAPIENTRY * PFNGLBINDPROGRAMARBPROC) (GLenum target, GLuint program);
+typedef void (GLAPIENTRY * PFNGLDELETEPROGRAMSARBPROC) (GLsizei n, const GLuint* programs);
+typedef void (GLAPIENTRY * PFNGLGENPROGRAMSARBPROC) (GLsizei n, GLuint* programs);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMENVPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMENVPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, void *string);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMIVARBPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, void** pointer);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBDVARBPROC) (GLuint index, GLenum pname, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBFVARBPROC) (GLuint index, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBIVARBPROC) (GLuint index, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISPROGRAMARBPROC) (GLuint program);
+typedef void (GLAPIENTRY * PFNGLPROGRAMENVPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMENVPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLPROGRAMENVPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMENVPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLPROGRAMLOCALPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMLOCALPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLPROGRAMLOCALPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMLOCALPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const void *string);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1DARBPROC) (GLuint index, GLdouble x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1DVARBPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1FARBPROC) (GLuint index, GLfloat x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1FVARBPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1SARBPROC) (GLuint index, GLshort x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1SVARBPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2DARBPROC) (GLuint index, GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2DVARBPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2FARBPROC) (GLuint index, GLfloat x, GLfloat y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2FVARBPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2SARBPROC) (GLuint index, GLshort x, GLshort y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2SVARBPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3DVARBPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3FVARBPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3SVARBPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NBVARBPROC) (GLuint index, const GLbyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NIVARBPROC) (GLuint index, const GLint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NSVARBPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUBARBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUBVARBPROC) (GLuint index, const GLubyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUIVARBPROC) (GLuint index, const GLuint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUSVARBPROC) (GLuint index, const GLushort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4BVARBPROC) (GLuint index, const GLbyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4DVARBPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4FVARBPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4IVARBPROC) (GLuint index, const GLint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4SVARBPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4UBVARBPROC) (GLuint index, const GLubyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4UIVARBPROC) (GLuint index, const GLuint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4USVARBPROC) (GLuint index, const GLushort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer);
+#define glBindProgramARB GLEW_GET_FUN(__glewBindProgramARB)
+#define glDeleteProgramsARB GLEW_GET_FUN(__glewDeleteProgramsARB)
+#define glDisableVertexAttribArrayARB GLEW_GET_FUN(__glewDisableVertexAttribArrayARB)
+#define glEnableVertexAttribArrayARB GLEW_GET_FUN(__glewEnableVertexAttribArrayARB)
+#define glGenProgramsARB GLEW_GET_FUN(__glewGenProgramsARB)
+#define glGetProgramEnvParameterdvARB GLEW_GET_FUN(__glewGetProgramEnvParameterdvARB)
+#define glGetProgramEnvParameterfvARB GLEW_GET_FUN(__glewGetProgramEnvParameterfvARB)
+#define glGetProgramLocalParameterdvARB GLEW_GET_FUN(__glewGetProgramLocalParameterdvARB)
+#define glGetProgramLocalParameterfvARB GLEW_GET_FUN(__glewGetProgramLocalParameterfvARB)
+#define glGetProgramStringARB GLEW_GET_FUN(__glewGetProgramStringARB)
+#define glGetProgramivARB GLEW_GET_FUN(__glewGetProgramivARB)
+#define glGetVertexAttribPointervARB GLEW_GET_FUN(__glewGetVertexAttribPointervARB)
+#define glGetVertexAttribdvARB GLEW_GET_FUN(__glewGetVertexAttribdvARB)
+#define glGetVertexAttribfvARB GLEW_GET_FUN(__glewGetVertexAttribfvARB)
+#define glGetVertexAttribivARB GLEW_GET_FUN(__glewGetVertexAttribivARB)
+#define glIsProgramARB GLEW_GET_FUN(__glewIsProgramARB)
+#define glProgramEnvParameter4dARB GLEW_GET_FUN(__glewProgramEnvParameter4dARB)
+#define glProgramEnvParameter4dvARB GLEW_GET_FUN(__glewProgramEnvParameter4dvARB)
+#define glProgramEnvParameter4fARB GLEW_GET_FUN(__glewProgramEnvParameter4fARB)
+#define glProgramEnvParameter4fvARB GLEW_GET_FUN(__glewProgramEnvParameter4fvARB)
+#define glProgramLocalParameter4dARB GLEW_GET_FUN(__glewProgramLocalParameter4dARB)
+#define glProgramLocalParameter4dvARB GLEW_GET_FUN(__glewProgramLocalParameter4dvARB)
+#define glProgramLocalParameter4fARB GLEW_GET_FUN(__glewProgramLocalParameter4fARB)
+#define glProgramLocalParameter4fvARB GLEW_GET_FUN(__glewProgramLocalParameter4fvARB)
+#define glProgramStringARB GLEW_GET_FUN(__glewProgramStringARB)
+#define glVertexAttrib1dARB GLEW_GET_FUN(__glewVertexAttrib1dARB)
+#define glVertexAttrib1dvARB GLEW_GET_FUN(__glewVertexAttrib1dvARB)
+#define glVertexAttrib1fARB GLEW_GET_FUN(__glewVertexAttrib1fARB)
+#define glVertexAttrib1fvARB GLEW_GET_FUN(__glewVertexAttrib1fvARB)
+#define glVertexAttrib1sARB GLEW_GET_FUN(__glewVertexAttrib1sARB)
+#define glVertexAttrib1svARB GLEW_GET_FUN(__glewVertexAttrib1svARB)
+#define glVertexAttrib2dARB GLEW_GET_FUN(__glewVertexAttrib2dARB)
+#define glVertexAttrib2dvARB GLEW_GET_FUN(__glewVertexAttrib2dvARB)
+#define glVertexAttrib2fARB GLEW_GET_FUN(__glewVertexAttrib2fARB)
+#define glVertexAttrib2fvARB GLEW_GET_FUN(__glewVertexAttrib2fvARB)
+#define glVertexAttrib2sARB GLEW_GET_FUN(__glewVertexAttrib2sARB)
+#define glVertexAttrib2svARB GLEW_GET_FUN(__glewVertexAttrib2svARB)
+#define glVertexAttrib3dARB GLEW_GET_FUN(__glewVertexAttrib3dARB)
+#define glVertexAttrib3dvARB GLEW_GET_FUN(__glewVertexAttrib3dvARB)
+#define glVertexAttrib3fARB GLEW_GET_FUN(__glewVertexAttrib3fARB)
+#define glVertexAttrib3fvARB GLEW_GET_FUN(__glewVertexAttrib3fvARB)
+#define glVertexAttrib3sARB GLEW_GET_FUN(__glewVertexAttrib3sARB)
+#define glVertexAttrib3svARB GLEW_GET_FUN(__glewVertexAttrib3svARB)
+#define glVertexAttrib4NbvARB GLEW_GET_FUN(__glewVertexAttrib4NbvARB)
+#define glVertexAttrib4NivARB GLEW_GET_FUN(__glewVertexAttrib4NivARB)
+#define glVertexAttrib4NsvARB GLEW_GET_FUN(__glewVertexAttrib4NsvARB)
+#define glVertexAttrib4NubARB GLEW_GET_FUN(__glewVertexAttrib4NubARB)
+#define glVertexAttrib4NubvARB GLEW_GET_FUN(__glewVertexAttrib4NubvARB)
+#define glVertexAttrib4NuivARB GLEW_GET_FUN(__glewVertexAttrib4NuivARB)
+#define glVertexAttrib4NusvARB GLEW_GET_FUN(__glewVertexAttrib4NusvARB)
+#define glVertexAttrib4bvARB GLEW_GET_FUN(__glewVertexAttrib4bvARB)
+#define glVertexAttrib4dARB GLEW_GET_FUN(__glewVertexAttrib4dARB)
+#define glVertexAttrib4dvARB GLEW_GET_FUN(__glewVertexAttrib4dvARB)
+#define glVertexAttrib4fARB GLEW_GET_FUN(__glewVertexAttrib4fARB)
+#define glVertexAttrib4fvARB GLEW_GET_FUN(__glewVertexAttrib4fvARB)
+#define glVertexAttrib4ivARB GLEW_GET_FUN(__glewVertexAttrib4ivARB)
+#define glVertexAttrib4sARB GLEW_GET_FUN(__glewVertexAttrib4sARB)
+#define glVertexAttrib4svARB GLEW_GET_FUN(__glewVertexAttrib4svARB)
+#define glVertexAttrib4ubvARB GLEW_GET_FUN(__glewVertexAttrib4ubvARB)
+#define glVertexAttrib4uivARB GLEW_GET_FUN(__glewVertexAttrib4uivARB)
+#define glVertexAttrib4usvARB GLEW_GET_FUN(__glewVertexAttrib4usvARB)
+#define glVertexAttribPointerARB GLEW_GET_FUN(__glewVertexAttribPointerARB)
+#define GLEW_ARB_vertex_program GLEW_GET_VAR(__GLEW_ARB_vertex_program)
+#endif /* GL_ARB_vertex_program */
+/* -------------------------- GL_ARB_vertex_shader ------------------------- */
+#ifndef GL_ARB_vertex_shader
+#define GL_ARB_vertex_shader 1
+#define GL_VERTEX_SHADER_ARB 0x8B31
+typedef void (GLAPIENTRY * PFNGLBINDATTRIBLOCATIONARBPROC) (GLhandleARB programObj, GLuint index, const GLcharARB* name);
+typedef void (GLAPIENTRY * PFNGLGETACTIVEATTRIBARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei* length, GLint *size, GLenum *type, GLcharARB *name);
+typedef GLint (GLAPIENTRY * PFNGLGETATTRIBLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB* name);
+#define glBindAttribLocationARB GLEW_GET_FUN(__glewBindAttribLocationARB)
+#define glGetActiveAttribARB GLEW_GET_FUN(__glewGetActiveAttribARB)
+#define glGetAttribLocationARB GLEW_GET_FUN(__glewGetAttribLocationARB)
+#define GLEW_ARB_vertex_shader GLEW_GET_VAR(__GLEW_ARB_vertex_shader)
+#endif /* GL_ARB_vertex_shader */
+/* ------------------- GL_ARB_vertex_type_10f_11f_11f_rev ------------------ */
+#ifndef GL_ARB_vertex_type_10f_11f_11f_rev
+#define GL_ARB_vertex_type_10f_11f_11f_rev 1
+#define GL_UNSIGNED_INT_10F_11F_11F_REV 0x8C3B
+#define GLEW_ARB_vertex_type_10f_11f_11f_rev GLEW_GET_VAR(__GLEW_ARB_vertex_type_10f_11f_11f_rev)
+#endif /* GL_ARB_vertex_type_10f_11f_11f_rev */
+/* ------------------- GL_ARB_vertex_type_2_10_10_10_rev ------------------- */
+#ifndef GL_ARB_vertex_type_2_10_10_10_rev
+#define GL_ARB_vertex_type_2_10_10_10_rev 1
+#define GL_UNSIGNED_INT_2_10_10_10_REV 0x8368
+#define GL_INT_2_10_10_10_REV 0x8D9F
+typedef void (GLAPIENTRY * PFNGLCOLORP3UIPROC) (GLenum type, GLuint color);
+typedef void (GLAPIENTRY * PFNGLCOLORP3UIVPROC) (GLenum type, const GLuint* color);
+typedef void (GLAPIENTRY * PFNGLCOLORP4UIPROC) (GLenum type, GLuint color);
+typedef void (GLAPIENTRY * PFNGLCOLORP4UIVPROC) (GLenum type, const GLuint* color);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORDP1UIPROC) (GLenum texture, GLenum type, GLuint coords);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORDP1UIVPROC) (GLenum texture, GLenum type, const GLuint* coords);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORDP2UIPROC) (GLenum texture, GLenum type, GLuint coords);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORDP2UIVPROC) (GLenum texture, GLenum type, const GLuint* coords);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORDP3UIPROC) (GLenum texture, GLenum type, GLuint coords);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORDP3UIVPROC) (GLenum texture, GLenum type, const GLuint* coords);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORDP4UIPROC) (GLenum texture, GLenum type, GLuint coords);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORDP4UIVPROC) (GLenum texture, GLenum type, const GLuint* coords);
+typedef void (GLAPIENTRY * PFNGLNORMALP3UIPROC) (GLenum type, GLuint coords);
+typedef void (GLAPIENTRY * PFNGLNORMALP3UIVPROC) (GLenum type, const GLuint* coords);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLORP3UIPROC) (GLenum type, GLuint color);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLORP3UIVPROC) (GLenum type, const GLuint* color);
+typedef void (GLAPIENTRY * PFNGLTEXCOORDP1UIPROC) (GLenum type, GLuint coords);
+typedef void (GLAPIENTRY * PFNGLTEXCOORDP1UIVPROC) (GLenum type, const GLuint* coords);
+typedef void (GLAPIENTRY * PFNGLTEXCOORDP2UIPROC) (GLenum type, GLuint coords);
+typedef void (GLAPIENTRY * PFNGLTEXCOORDP2UIVPROC) (GLenum type, const GLuint* coords);
+typedef void (GLAPIENTRY * PFNGLTEXCOORDP3UIPROC) (GLenum type, GLuint coords);
+typedef void (GLAPIENTRY * PFNGLTEXCOORDP3UIVPROC) (GLenum type, const GLuint* coords);
+typedef void (GLAPIENTRY * PFNGLTEXCOORDP4UIPROC) (GLenum type, GLuint coords);
+typedef void (GLAPIENTRY * PFNGLTEXCOORDP4UIVPROC) (GLenum type, const GLuint* coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBP1UIPROC) (GLuint index, GLenum type, GLboolean normalized, GLuint value);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBP1UIVPROC) (GLuint index, GLenum type, GLboolean normalized, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBP2UIPROC) (GLuint index, GLenum type, GLboolean normalized, GLuint value);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBP2UIVPROC) (GLuint index, GLenum type, GLboolean normalized, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBP3UIPROC) (GLuint index, GLenum type, GLboolean normalized, GLuint value);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBP3UIVPROC) (GLuint index, GLenum type, GLboolean normalized, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBP4UIPROC) (GLuint index, GLenum type, GLboolean normalized, GLuint value);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBP4UIVPROC) (GLuint index, GLenum type, GLboolean normalized, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLVERTEXP2UIPROC) (GLenum type, GLuint value);
+typedef void (GLAPIENTRY * PFNGLVERTEXP2UIVPROC) (GLenum type, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLVERTEXP3UIPROC) (GLenum type, GLuint value);
+typedef void (GLAPIENTRY * PFNGLVERTEXP3UIVPROC) (GLenum type, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLVERTEXP4UIPROC) (GLenum type, GLuint value);
+typedef void (GLAPIENTRY * PFNGLVERTEXP4UIVPROC) (GLenum type, const GLuint* value);
+#define glColorP3ui GLEW_GET_FUN(__glewColorP3ui)
+#define glColorP3uiv GLEW_GET_FUN(__glewColorP3uiv)
+#define glColorP4ui GLEW_GET_FUN(__glewColorP4ui)
+#define glColorP4uiv GLEW_GET_FUN(__glewColorP4uiv)
+#define glMultiTexCoordP1ui GLEW_GET_FUN(__glewMultiTexCoordP1ui)
+#define glMultiTexCoordP1uiv GLEW_GET_FUN(__glewMultiTexCoordP1uiv)
+#define glMultiTexCoordP2ui GLEW_GET_FUN(__glewMultiTexCoordP2ui)
+#define glMultiTexCoordP2uiv GLEW_GET_FUN(__glewMultiTexCoordP2uiv)
+#define glMultiTexCoordP3ui GLEW_GET_FUN(__glewMultiTexCoordP3ui)
+#define glMultiTexCoordP3uiv GLEW_GET_FUN(__glewMultiTexCoordP3uiv)
+#define glMultiTexCoordP4ui GLEW_GET_FUN(__glewMultiTexCoordP4ui)
+#define glMultiTexCoordP4uiv GLEW_GET_FUN(__glewMultiTexCoordP4uiv)
+#define glNormalP3ui GLEW_GET_FUN(__glewNormalP3ui)
+#define glNormalP3uiv GLEW_GET_FUN(__glewNormalP3uiv)
+#define glSecondaryColorP3ui GLEW_GET_FUN(__glewSecondaryColorP3ui)
+#define glSecondaryColorP3uiv GLEW_GET_FUN(__glewSecondaryColorP3uiv)
+#define glTexCoordP1ui GLEW_GET_FUN(__glewTexCoordP1ui)
+#define glTexCoordP1uiv GLEW_GET_FUN(__glewTexCoordP1uiv)
+#define glTexCoordP2ui GLEW_GET_FUN(__glewTexCoordP2ui)
+#define glTexCoordP2uiv GLEW_GET_FUN(__glewTexCoordP2uiv)
+#define glTexCoordP3ui GLEW_GET_FUN(__glewTexCoordP3ui)
+#define glTexCoordP3uiv GLEW_GET_FUN(__glewTexCoordP3uiv)
+#define glTexCoordP4ui GLEW_GET_FUN(__glewTexCoordP4ui)
+#define glTexCoordP4uiv GLEW_GET_FUN(__glewTexCoordP4uiv)
+#define glVertexAttribP1ui GLEW_GET_FUN(__glewVertexAttribP1ui)
+#define glVertexAttribP1uiv GLEW_GET_FUN(__glewVertexAttribP1uiv)
+#define glVertexAttribP2ui GLEW_GET_FUN(__glewVertexAttribP2ui)
+#define glVertexAttribP2uiv GLEW_GET_FUN(__glewVertexAttribP2uiv)
+#define glVertexAttribP3ui GLEW_GET_FUN(__glewVertexAttribP3ui)
+#define glVertexAttribP3uiv GLEW_GET_FUN(__glewVertexAttribP3uiv)
+#define glVertexAttribP4ui GLEW_GET_FUN(__glewVertexAttribP4ui)
+#define glVertexAttribP4uiv GLEW_GET_FUN(__glewVertexAttribP4uiv)
+#define glVertexP2ui GLEW_GET_FUN(__glewVertexP2ui)
+#define glVertexP2uiv GLEW_GET_FUN(__glewVertexP2uiv)
+#define glVertexP3ui GLEW_GET_FUN(__glewVertexP3ui)
+#define glVertexP3uiv GLEW_GET_FUN(__glewVertexP3uiv)
+#define glVertexP4ui GLEW_GET_FUN(__glewVertexP4ui)
+#define glVertexP4uiv GLEW_GET_FUN(__glewVertexP4uiv)
+#define GLEW_ARB_vertex_type_2_10_10_10_rev GLEW_GET_VAR(__GLEW_ARB_vertex_type_2_10_10_10_rev)
+#endif /* GL_ARB_vertex_type_2_10_10_10_rev */
+/* ------------------------- GL_ARB_viewport_array ------------------------- */
+#ifndef GL_ARB_viewport_array
+#define GL_ARB_viewport_array 1
+#define GL_DEPTH_RANGE 0x0B70
+#define GL_VIEWPORT 0x0BA2
+#define GL_SCISSOR_BOX 0x0C10
+#define GL_SCISSOR_TEST 0x0C11
+#define GL_MAX_VIEWPORTS 0x825B
+#define GL_UNDEFINED_VERTEX 0x8260
+typedef void (GLAPIENTRY * PFNGLDEPTHRANGEARRAYVPROC) (GLuint first, GLsizei count, const GLclampd * v);
+typedef void (GLAPIENTRY * PFNGLDEPTHRANGEINDEXEDPROC) (GLuint index, GLclampd n, GLclampd f);
+typedef void (GLAPIENTRY * PFNGLGETDOUBLEI_VPROC) (GLenum target, GLuint index, GLdouble* data);
+typedef void (GLAPIENTRY * PFNGLGETFLOATI_VPROC) (GLenum target, GLuint index, GLfloat* data);
+typedef void (GLAPIENTRY * PFNGLSCISSORARRAYVPROC) (GLuint first, GLsizei count, const GLint * v);
+typedef void (GLAPIENTRY * PFNGLSCISSORINDEXEDPROC) (GLuint index, GLint left, GLint bottom, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLSCISSORINDEXEDVPROC) (GLuint index, const GLint * v);
+typedef void (GLAPIENTRY * PFNGLVIEWPORTARRAYVPROC) (GLuint first, GLsizei count, const GLfloat * v);
+typedef void (GLAPIENTRY * PFNGLVIEWPORTINDEXEDFPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat w, GLfloat h);
+typedef void (GLAPIENTRY * PFNGLVIEWPORTINDEXEDFVPROC) (GLuint index, const GLfloat * v);
+#define glDepthRangeArrayv GLEW_GET_FUN(__glewDepthRangeArrayv)
+#define glDepthRangeIndexed GLEW_GET_FUN(__glewDepthRangeIndexed)
+#define glGetDoublei_v GLEW_GET_FUN(__glewGetDoublei_v)
+#define glGetFloati_v GLEW_GET_FUN(__glewGetFloati_v)
+#define glScissorArrayv GLEW_GET_FUN(__glewScissorArrayv)
+#define glScissorIndexed GLEW_GET_FUN(__glewScissorIndexed)
+#define glScissorIndexedv GLEW_GET_FUN(__glewScissorIndexedv)
+#define glViewportArrayv GLEW_GET_FUN(__glewViewportArrayv)
+#define glViewportIndexedf GLEW_GET_FUN(__glewViewportIndexedf)
+#define glViewportIndexedfv GLEW_GET_FUN(__glewViewportIndexedfv)
+#define GLEW_ARB_viewport_array GLEW_GET_VAR(__GLEW_ARB_viewport_array)
+#endif /* GL_ARB_viewport_array */
+/* --------------------------- GL_ARB_window_pos --------------------------- */
+#ifndef GL_ARB_window_pos
+#define GL_ARB_window_pos 1
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2DARBPROC) (GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2DVARBPROC) (const GLdouble* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2FARBPROC) (GLfloat x, GLfloat y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2FVARBPROC) (const GLfloat* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2IARBPROC) (GLint x, GLint y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2IVARBPROC) (const GLint* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2SARBPROC) (GLshort x, GLshort y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2SVARBPROC) (const GLshort* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3DARBPROC) (GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3DVARBPROC) (const GLdouble* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3FARBPROC) (GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3FVARBPROC) (const GLfloat* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3IARBPROC) (GLint x, GLint y, GLint z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3IVARBPROC) (const GLint* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3SARBPROC) (GLshort x, GLshort y, GLshort z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3SVARBPROC) (const GLshort* p);
+#define glWindowPos2dARB GLEW_GET_FUN(__glewWindowPos2dARB)
+#define glWindowPos2dvARB GLEW_GET_FUN(__glewWindowPos2dvARB)
+#define glWindowPos2fARB GLEW_GET_FUN(__glewWindowPos2fARB)
+#define glWindowPos2fvARB GLEW_GET_FUN(__glewWindowPos2fvARB)
+#define glWindowPos2iARB GLEW_GET_FUN(__glewWindowPos2iARB)
+#define glWindowPos2ivARB GLEW_GET_FUN(__glewWindowPos2ivARB)
+#define glWindowPos2sARB GLEW_GET_FUN(__glewWindowPos2sARB)
+#define glWindowPos2svARB GLEW_GET_FUN(__glewWindowPos2svARB)
+#define glWindowPos3dARB GLEW_GET_FUN(__glewWindowPos3dARB)
+#define glWindowPos3dvARB GLEW_GET_FUN(__glewWindowPos3dvARB)
+#define glWindowPos3fARB GLEW_GET_FUN(__glewWindowPos3fARB)
+#define glWindowPos3fvARB GLEW_GET_FUN(__glewWindowPos3fvARB)
+#define glWindowPos3iARB GLEW_GET_FUN(__glewWindowPos3iARB)
+#define glWindowPos3ivARB GLEW_GET_FUN(__glewWindowPos3ivARB)
+#define glWindowPos3sARB GLEW_GET_FUN(__glewWindowPos3sARB)
+#define glWindowPos3svARB GLEW_GET_FUN(__glewWindowPos3svARB)
+#define GLEW_ARB_window_pos GLEW_GET_VAR(__GLEW_ARB_window_pos)
+#endif /* GL_ARB_window_pos */
+/* ----------------------- GL_ARM_mali_program_binary ---------------------- */
+#ifndef GL_ARM_mali_program_binary
+#define GL_ARM_mali_program_binary 1
+#define GLEW_ARM_mali_program_binary GLEW_GET_VAR(__GLEW_ARM_mali_program_binary)
+#endif /* GL_ARM_mali_program_binary */
+/* ----------------------- GL_ARM_mali_shader_binary ----------------------- */
+#ifndef GL_ARM_mali_shader_binary
+#define GL_ARM_mali_shader_binary 1
+#define GLEW_ARM_mali_shader_binary GLEW_GET_VAR(__GLEW_ARM_mali_shader_binary)
+#endif /* GL_ARM_mali_shader_binary */
+/* ------------------------------ GL_ARM_rgba8 ----------------------------- */
+#ifndef GL_ARM_rgba8
+#define GL_ARM_rgba8 1
+#define GL_RGBA8_OES 0x8058
+#define GLEW_ARM_rgba8 GLEW_GET_VAR(__GLEW_ARM_rgba8)
+#endif /* GL_ARM_rgba8 */
+/* -------------------- GL_ARM_shader_framebuffer_fetch -------------------- */
+#ifndef GL_ARM_shader_framebuffer_fetch
+#define GL_ARM_shader_framebuffer_fetch 1
+#define GLEW_ARM_shader_framebuffer_fetch GLEW_GET_VAR(__GLEW_ARM_shader_framebuffer_fetch)
+#endif /* GL_ARM_shader_framebuffer_fetch */
+/* ------------- GL_ARM_shader_framebuffer_fetch_depth_stencil ------------- */
+#ifndef GL_ARM_shader_framebuffer_fetch_depth_stencil
+#define GL_ARM_shader_framebuffer_fetch_depth_stencil 1
+#define GLEW_ARM_shader_framebuffer_fetch_depth_stencil GLEW_GET_VAR(__GLEW_ARM_shader_framebuffer_fetch_depth_stencil)
+#endif /* GL_ARM_shader_framebuffer_fetch_depth_stencil */
+/* ------------------------- GL_ATIX_point_sprites ------------------------- */
+#ifndef GL_ATIX_point_sprites
+#define GL_ATIX_point_sprites 1
+#define GLEW_ATIX_point_sprites GLEW_GET_VAR(__GLEW_ATIX_point_sprites)
+#endif /* GL_ATIX_point_sprites */
+/* ---------------------- GL_ATIX_texture_env_combine3 --------------------- */
+#ifndef GL_ATIX_texture_env_combine3
+#define GL_ATIX_texture_env_combine3 1
+#define GL_MODULATE_ADD_ATIX 0x8744
+#define GLEW_ATIX_texture_env_combine3 GLEW_GET_VAR(__GLEW_ATIX_texture_env_combine3)
+#endif /* GL_ATIX_texture_env_combine3 */
+/* ----------------------- GL_ATIX_texture_env_route ----------------------- */
+#ifndef GL_ATIX_texture_env_route
+#define GL_ATIX_texture_env_route 1
+#define GLEW_ATIX_texture_env_route GLEW_GET_VAR(__GLEW_ATIX_texture_env_route)
+#endif /* GL_ATIX_texture_env_route */
+/* ---------------- GL_ATIX_vertex_shader_output_point_size ---------------- */
+#ifndef GL_ATIX_vertex_shader_output_point_size
+#define GL_ATIX_vertex_shader_output_point_size 1
+#define GLEW_ATIX_vertex_shader_output_point_size GLEW_GET_VAR(__GLEW_ATIX_vertex_shader_output_point_size)
+#endif /* GL_ATIX_vertex_shader_output_point_size */
+/* -------------------------- GL_ATI_draw_buffers -------------------------- */
+#ifndef GL_ATI_draw_buffers
+#define GL_ATI_draw_buffers 1
+#define GL_MAX_DRAW_BUFFERS_ATI 0x8824
+#define GL_DRAW_BUFFER0_ATI 0x8825
+#define GL_DRAW_BUFFER1_ATI 0x8826
+#define GL_DRAW_BUFFER2_ATI 0x8827
+#define GL_DRAW_BUFFER3_ATI 0x8828
+#define GL_DRAW_BUFFER4_ATI 0x8829
+#define GL_DRAW_BUFFER5_ATI 0x882A
+#define GL_DRAW_BUFFER6_ATI 0x882B
+#define GL_DRAW_BUFFER7_ATI 0x882C
+#define GL_DRAW_BUFFER8_ATI 0x882D
+#define GL_DRAW_BUFFER9_ATI 0x882E
+#define GL_DRAW_BUFFER10_ATI 0x882F
+#define GL_DRAW_BUFFER11_ATI 0x8830
+#define GL_DRAW_BUFFER12_ATI 0x8831
+#define GL_DRAW_BUFFER13_ATI 0x8832
+#define GL_DRAW_BUFFER14_ATI 0x8833
+#define GL_DRAW_BUFFER15_ATI 0x8834
+typedef void (GLAPIENTRY * PFNGLDRAWBUFFERSATIPROC) (GLsizei n, const GLenum* bufs);
+#define glDrawBuffersATI GLEW_GET_FUN(__glewDrawBuffersATI)
+#define GLEW_ATI_draw_buffers GLEW_GET_VAR(__GLEW_ATI_draw_buffers)
+#endif /* GL_ATI_draw_buffers */
+/* -------------------------- GL_ATI_element_array ------------------------- */
+#ifndef GL_ATI_element_array
+#define GL_ATI_element_array 1
+#define GL_ELEMENT_ARRAY_ATI 0x8768
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTARRAYATIPROC) (GLenum mode, GLsizei count);
+typedef void (GLAPIENTRY * PFNGLDRAWRANGEELEMENTARRAYATIPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count);
+typedef void (GLAPIENTRY * PFNGLELEMENTPOINTERATIPROC) (GLenum type, const void *pointer);
+#define glDrawElementArrayATI GLEW_GET_FUN(__glewDrawElementArrayATI)
+#define glDrawRangeElementArrayATI GLEW_GET_FUN(__glewDrawRangeElementArrayATI)
+#define glElementPointerATI GLEW_GET_FUN(__glewElementPointerATI)
+#define GLEW_ATI_element_array GLEW_GET_VAR(__GLEW_ATI_element_array)
+#endif /* GL_ATI_element_array */
+/* ------------------------- GL_ATI_envmap_bumpmap ------------------------- */
+#ifndef GL_ATI_envmap_bumpmap
+#define GL_ATI_envmap_bumpmap 1
+#define GL_BUMP_ROT_MATRIX_ATI 0x8775
+#define GL_BUMP_NUM_TEX_UNITS_ATI 0x8777
+#define GL_BUMP_TEX_UNITS_ATI 0x8778
+#define GL_DUDV_ATI 0x8779
+#define GL_DU8DV8_ATI 0x877A
+#define GL_BUMP_ENVMAP_ATI 0x877B
+#define GL_BUMP_TARGET_ATI 0x877C
+typedef void (GLAPIENTRY * PFNGLGETTEXBUMPPARAMETERFVATIPROC) (GLenum pname, GLfloat *param);
+typedef void (GLAPIENTRY * PFNGLTEXBUMPPARAMETERFVATIPROC) (GLenum pname, GLfloat *param);
+typedef void (GLAPIENTRY * PFNGLTEXBUMPPARAMETERIVATIPROC) (GLenum pname, GLint *param);
+#define glGetTexBumpParameterfvATI GLEW_GET_FUN(__glewGetTexBumpParameterfvATI)
+#define glGetTexBumpParameterivATI GLEW_GET_FUN(__glewGetTexBumpParameterivATI)
+#define glTexBumpParameterfvATI GLEW_GET_FUN(__glewTexBumpParameterfvATI)
+#define glTexBumpParameterivATI GLEW_GET_FUN(__glewTexBumpParameterivATI)
+#define GLEW_ATI_envmap_bumpmap GLEW_GET_VAR(__GLEW_ATI_envmap_bumpmap)
+#endif /* GL_ATI_envmap_bumpmap */
+/* ------------------------- GL_ATI_fragment_shader ------------------------ */
+#ifndef GL_ATI_fragment_shader
+#define GL_ATI_fragment_shader 1
+#define GL_2X_BIT_ATI 0x00000001
+#define GL_RED_BIT_ATI 0x00000001
+#define GL_4X_BIT_ATI 0x00000002
+#define GL_COMP_BIT_ATI 0x00000002
+#define GL_GREEN_BIT_ATI 0x00000002
+#define GL_8X_BIT_ATI 0x00000004
+#define GL_BLUE_BIT_ATI 0x00000004
+#define GL_NEGATE_BIT_ATI 0x00000004
+#define GL_BIAS_BIT_ATI 0x00000008
+#define GL_HALF_BIT_ATI 0x00000008
+#define GL_QUARTER_BIT_ATI 0x00000010
+#define GL_EIGHTH_BIT_ATI 0x00000020
+#define GL_SATURATE_BIT_ATI 0x00000040
+#define GL_FRAGMENT_SHADER_ATI 0x8920
+#define GL_REG_0_ATI 0x8921
+#define GL_REG_1_ATI 0x8922
+#define GL_REG_2_ATI 0x8923
+#define GL_REG_3_ATI 0x8924
+#define GL_REG_4_ATI 0x8925
+#define GL_REG_5_ATI 0x8926
+#define GL_CON_0_ATI 0x8941
+#define GL_CON_1_ATI 0x8942
+#define GL_CON_2_ATI 0x8943
+#define GL_CON_3_ATI 0x8944
+#define GL_CON_4_ATI 0x8945
+#define GL_CON_5_ATI 0x8946
+#define GL_CON_6_ATI 0x8947
+#define GL_CON_7_ATI 0x8948
+#define GL_MOV_ATI 0x8961
+#define GL_ADD_ATI 0x8963
+#define GL_MUL_ATI 0x8964
+#define GL_SUB_ATI 0x8965
+#define GL_DOT3_ATI 0x8966
+#define GL_DOT4_ATI 0x8967
+#define GL_MAD_ATI 0x8968
+#define GL_LERP_ATI 0x8969
+#define GL_CND_ATI 0x896A
+#define GL_CND0_ATI 0x896B
+#define GL_DOT2_ADD_ATI 0x896C
+#define GL_NUM_PASSES_ATI 0x8970
+#define GL_SWIZZLE_STR_ATI 0x8976
+#define GL_SWIZZLE_STQ_ATI 0x8977
+#define GL_SWIZZLE_STR_DR_ATI 0x8978
+#define GL_SWIZZLE_STQ_DQ_ATI 0x8979
+#define GL_SWIZZLE_STRQ_ATI 0x897A
+#define GL_SWIZZLE_STRQ_DQ_ATI 0x897B
+typedef void (GLAPIENTRY * PFNGLALPHAFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod);
+typedef void (GLAPIENTRY * PFNGLALPHAFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod);
+typedef void (GLAPIENTRY * PFNGLALPHAFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod);
+typedef void (GLAPIENTRY * PFNGLCOLORFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod);
+typedef void (GLAPIENTRY * PFNGLCOLORFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod);
+typedef void (GLAPIENTRY * PFNGLCOLORFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod);
+typedef void (GLAPIENTRY * PFNGLPASSTEXCOORDATIPROC) (GLuint dst, GLuint coord, GLenum swizzle);
+typedef void (GLAPIENTRY * PFNGLSAMPLEMAPATIPROC) (GLuint dst, GLuint interp, GLenum swizzle);
+typedef void (GLAPIENTRY * PFNGLSETFRAGMENTSHADERCONSTANTATIPROC) (GLuint dst, const GLfloat* value);
+#define glAlphaFragmentOp1ATI GLEW_GET_FUN(__glewAlphaFragmentOp1ATI)
+#define glAlphaFragmentOp2ATI GLEW_GET_FUN(__glewAlphaFragmentOp2ATI)
+#define glAlphaFragmentOp3ATI GLEW_GET_FUN(__glewAlphaFragmentOp3ATI)
+#define glBeginFragmentShaderATI GLEW_GET_FUN(__glewBeginFragmentShaderATI)
+#define glBindFragmentShaderATI GLEW_GET_FUN(__glewBindFragmentShaderATI)
+#define glColorFragmentOp1ATI GLEW_GET_FUN(__glewColorFragmentOp1ATI)
+#define glColorFragmentOp2ATI GLEW_GET_FUN(__glewColorFragmentOp2ATI)
+#define glColorFragmentOp3ATI GLEW_GET_FUN(__glewColorFragmentOp3ATI)
+#define glDeleteFragmentShaderATI GLEW_GET_FUN(__glewDeleteFragmentShaderATI)
+#define glEndFragmentShaderATI GLEW_GET_FUN(__glewEndFragmentShaderATI)
+#define glGenFragmentShadersATI GLEW_GET_FUN(__glewGenFragmentShadersATI)
+#define glPassTexCoordATI GLEW_GET_FUN(__glewPassTexCoordATI)
+#define glSampleMapATI GLEW_GET_FUN(__glewSampleMapATI)
+#define glSetFragmentShaderConstantATI GLEW_GET_FUN(__glewSetFragmentShaderConstantATI)
+#define GLEW_ATI_fragment_shader GLEW_GET_VAR(__GLEW_ATI_fragment_shader)
+#endif /* GL_ATI_fragment_shader */
+/* ------------------------ GL_ATI_map_object_buffer ----------------------- */
+#ifndef GL_ATI_map_object_buffer
+#define GL_ATI_map_object_buffer 1
+#define glMapObjectBufferATI GLEW_GET_FUN(__glewMapObjectBufferATI)
+#define glUnmapObjectBufferATI GLEW_GET_FUN(__glewUnmapObjectBufferATI)
+#define GLEW_ATI_map_object_buffer GLEW_GET_VAR(__GLEW_ATI_map_object_buffer)
+#endif /* GL_ATI_map_object_buffer */
+/* ----------------------------- GL_ATI_meminfo ---------------------------- */
+#ifndef GL_ATI_meminfo
+#define GL_ATI_meminfo 1
+#define GLEW_ATI_meminfo GLEW_GET_VAR(__GLEW_ATI_meminfo)
+#endif /* GL_ATI_meminfo */
+/* -------------------------- GL_ATI_pn_triangles -------------------------- */
+#ifndef GL_ATI_pn_triangles
+#define GL_ATI_pn_triangles 1
+#define GL_PN_TRIANGLES_ATI 0x87F0
+typedef void (GLAPIENTRY * PFNGLPNTRIANGLESFATIPROC) (GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLPNTRIANGLESIATIPROC) (GLenum pname, GLint param);
+#define glPNTrianglesfATI GLEW_GET_FUN(__glewPNTrianglesfATI)
+#define glPNTrianglesiATI GLEW_GET_FUN(__glewPNTrianglesiATI)
+#define GLEW_ATI_pn_triangles GLEW_GET_VAR(__GLEW_ATI_pn_triangles)
+#endif /* GL_ATI_pn_triangles */
+/* ------------------------ GL_ATI_separate_stencil ------------------------ */
+#ifndef GL_ATI_separate_stencil
+#define GL_ATI_separate_stencil 1
+#define GL_STENCIL_BACK_FUNC_ATI 0x8800
+#define GL_STENCIL_BACK_FAIL_ATI 0x8801
+typedef void (GLAPIENTRY * PFNGLSTENCILFUNCSEPARATEATIPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask);
+typedef void (GLAPIENTRY * PFNGLSTENCILOPSEPARATEATIPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass);
+#define glStencilFuncSeparateATI GLEW_GET_FUN(__glewStencilFuncSeparateATI)
+#define glStencilOpSeparateATI GLEW_GET_FUN(__glewStencilOpSeparateATI)
+#define GLEW_ATI_separate_stencil GLEW_GET_VAR(__GLEW_ATI_separate_stencil)
+#endif /* GL_ATI_separate_stencil */
+/* ----------------------- GL_ATI_shader_texture_lod ----------------------- */
+#ifndef GL_ATI_shader_texture_lod
+#define GL_ATI_shader_texture_lod 1
+#define GLEW_ATI_shader_texture_lod GLEW_GET_VAR(__GLEW_ATI_shader_texture_lod)
+#endif /* GL_ATI_shader_texture_lod */
+/* ---------------------- GL_ATI_text_fragment_shader ---------------------- */
+#ifndef GL_ATI_text_fragment_shader
+#define GL_ATI_text_fragment_shader 1
+#define GLEW_ATI_text_fragment_shader GLEW_GET_VAR(__GLEW_ATI_text_fragment_shader)
+#endif /* GL_ATI_text_fragment_shader */
+/* --------------------- GL_ATI_texture_compression_3dc -------------------- */
+#ifndef GL_ATI_texture_compression_3dc
+#define GL_ATI_texture_compression_3dc 1
+#define GLEW_ATI_texture_compression_3dc GLEW_GET_VAR(__GLEW_ATI_texture_compression_3dc)
+#endif /* GL_ATI_texture_compression_3dc */
+/* ---------------------- GL_ATI_texture_env_combine3 ---------------------- */
+#ifndef GL_ATI_texture_env_combine3
+#define GL_ATI_texture_env_combine3 1
+#define GL_MODULATE_ADD_ATI 0x8744
+#define GLEW_ATI_texture_env_combine3 GLEW_GET_VAR(__GLEW_ATI_texture_env_combine3)
+#endif /* GL_ATI_texture_env_combine3 */
+/* -------------------------- GL_ATI_texture_float ------------------------- */
+#ifndef GL_ATI_texture_float
+#define GL_ATI_texture_float 1
+#define GL_RGBA_FLOAT32_ATI 0x8814
+#define GL_RGB_FLOAT32_ATI 0x8815
+#define GL_ALPHA_FLOAT32_ATI 0x8816
+#define GL_INTENSITY_FLOAT32_ATI 0x8817
+#define GL_LUMINANCE_FLOAT32_ATI 0x8818
+#define GL_RGBA_FLOAT16_ATI 0x881A
+#define GL_RGB_FLOAT16_ATI 0x881B
+#define GL_ALPHA_FLOAT16_ATI 0x881C
+#define GL_INTENSITY_FLOAT16_ATI 0x881D
+#define GL_LUMINANCE_FLOAT16_ATI 0x881E
+#define GLEW_ATI_texture_float GLEW_GET_VAR(__GLEW_ATI_texture_float)
+#endif /* GL_ATI_texture_float */
+/* ----------------------- GL_ATI_texture_mirror_once ---------------------- */
+#ifndef GL_ATI_texture_mirror_once
+#define GL_ATI_texture_mirror_once 1
+#define GL_MIRROR_CLAMP_ATI 0x8742
+#define GLEW_ATI_texture_mirror_once GLEW_GET_VAR(__GLEW_ATI_texture_mirror_once)
+#endif /* GL_ATI_texture_mirror_once */
+/* ----------------------- GL_ATI_vertex_array_object ---------------------- */
+#ifndef GL_ATI_vertex_array_object
+#define GL_ATI_vertex_array_object 1
+#define GL_STATIC_ATI 0x8760
+#define GL_DYNAMIC_ATI 0x8761
+#define GL_PRESERVE_ATI 0x8762
+#define GL_DISCARD_ATI 0x8763
+typedef void (GLAPIENTRY * PFNGLARRAYOBJECTATIPROC) (GLenum array, GLint size, GLenum type, GLsizei stride, GLuint buffer, GLuint offset);
+typedef void (GLAPIENTRY * PFNGLGETARRAYOBJECTFVATIPROC) (GLenum array, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETARRAYOBJECTIVATIPROC) (GLenum array, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETOBJECTBUFFERFVATIPROC) (GLuint buffer, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETOBJECTBUFFERIVATIPROC) (GLuint buffer, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETVARIANTARRAYOBJECTFVATIPROC) (GLuint id, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETVARIANTARRAYOBJECTIVATIPROC) (GLuint id, GLenum pname, GLint* params);
+typedef GLuint (GLAPIENTRY * PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const void *pointer, GLenum usage);
+typedef void (GLAPIENTRY * PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const void *pointer, GLenum preserve);
+typedef void (GLAPIENTRY * PFNGLVARIANTARRAYOBJECTATIPROC) (GLuint id, GLenum type, GLsizei stride, GLuint buffer, GLuint offset);
+#define glArrayObjectATI GLEW_GET_FUN(__glewArrayObjectATI)
+#define glFreeObjectBufferATI GLEW_GET_FUN(__glewFreeObjectBufferATI)
+#define glGetArrayObjectfvATI GLEW_GET_FUN(__glewGetArrayObjectfvATI)
+#define glGetArrayObjectivATI GLEW_GET_FUN(__glewGetArrayObjectivATI)
+#define glGetObjectBufferfvATI GLEW_GET_FUN(__glewGetObjectBufferfvATI)
+#define glGetObjectBufferivATI GLEW_GET_FUN(__glewGetObjectBufferivATI)
+#define glGetVariantArrayObjectfvATI GLEW_GET_FUN(__glewGetVariantArrayObjectfvATI)
+#define glGetVariantArrayObjectivATI GLEW_GET_FUN(__glewGetVariantArrayObjectivATI)
+#define glIsObjectBufferATI GLEW_GET_FUN(__glewIsObjectBufferATI)
+#define glNewObjectBufferATI GLEW_GET_FUN(__glewNewObjectBufferATI)
+#define glUpdateObjectBufferATI GLEW_GET_FUN(__glewUpdateObjectBufferATI)
+#define glVariantArrayObjectATI GLEW_GET_FUN(__glewVariantArrayObjectATI)
+#define GLEW_ATI_vertex_array_object GLEW_GET_VAR(__GLEW_ATI_vertex_array_object)
+#endif /* GL_ATI_vertex_array_object */
+/* ------------------- GL_ATI_vertex_attrib_array_object ------------------- */
+#ifndef GL_ATI_vertex_attrib_array_object
+#define GL_ATI_vertex_attrib_array_object 1
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBARRAYOBJECTFVATIPROC) (GLuint index, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBARRAYOBJECTIVATIPROC) (GLuint index, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBARRAYOBJECTATIPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLuint buffer, GLuint offset);
+#define glGetVertexAttribArrayObjectfvATI GLEW_GET_FUN(__glewGetVertexAttribArrayObjectfvATI)
+#define glGetVertexAttribArrayObjectivATI GLEW_GET_FUN(__glewGetVertexAttribArrayObjectivATI)
+#define glVertexAttribArrayObjectATI GLEW_GET_FUN(__glewVertexAttribArrayObjectATI)
+#define GLEW_ATI_vertex_attrib_array_object GLEW_GET_VAR(__GLEW_ATI_vertex_attrib_array_object)
+#endif /* GL_ATI_vertex_attrib_array_object */
+/* ------------------------- GL_ATI_vertex_streams ------------------------- */
+#ifndef GL_ATI_vertex_streams
+#define GL_ATI_vertex_streams 1
+#define GL_VERTEX_SOURCE_ATI 0x876C
+#define GL_VERTEX_STREAM0_ATI 0x876D
+#define GL_VERTEX_STREAM1_ATI 0x876E
+#define GL_VERTEX_STREAM2_ATI 0x876F
+#define GL_VERTEX_STREAM3_ATI 0x8770
+#define GL_VERTEX_STREAM4_ATI 0x8771
+#define GL_VERTEX_STREAM5_ATI 0x8772
+#define GL_VERTEX_STREAM6_ATI 0x8773
+#define GL_VERTEX_STREAM7_ATI 0x8774
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3BATIPROC) (GLenum stream, GLbyte x, GLbyte y, GLbyte z);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3BVATIPROC) (GLenum stream, const GLbyte *coords);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3IATIPROC) (GLenum stream, GLint x, GLint y, GLint z);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3IVATIPROC) (GLenum stream, const GLint *coords);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXBLENDENVFATIPROC) (GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLVERTEXBLENDENVIATIPROC) (GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM1DATIPROC) (GLenum stream, GLdouble x);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM1DVATIPROC) (GLenum stream, const GLdouble *coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM1FATIPROC) (GLenum stream, GLfloat x);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM1FVATIPROC) (GLenum stream, const GLfloat *coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM1IATIPROC) (GLenum stream, GLint x);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM1IVATIPROC) (GLenum stream, const GLint *coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM1SATIPROC) (GLenum stream, GLshort x);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM1SVATIPROC) (GLenum stream, const GLshort *coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM2DATIPROC) (GLenum stream, GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM2DVATIPROC) (GLenum stream, const GLdouble *coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM2FATIPROC) (GLenum stream, GLfloat x, GLfloat y);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM2FVATIPROC) (GLenum stream, const GLfloat *coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM2IATIPROC) (GLenum stream, GLint x, GLint y);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM2IVATIPROC) (GLenum stream, const GLint *coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM2SATIPROC) (GLenum stream, GLshort x, GLshort y);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM2SVATIPROC) (GLenum stream, const GLshort *coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM3DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM3FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM3IATIPROC) (GLenum stream, GLint x, GLint y, GLint z);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM3IVATIPROC) (GLenum stream, const GLint *coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM3SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4DVATIPROC) (GLenum stream, const GLdouble *coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4FVATIPROC) (GLenum stream, const GLfloat *coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4IATIPROC) (GLenum stream, GLint x, GLint y, GLint z, GLint w);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4IVATIPROC) (GLenum stream, const GLint *coords);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4SVATIPROC) (GLenum stream, const GLshort *coords);
+#define glClientActiveVertexStreamATI GLEW_GET_FUN(__glewClientActiveVertexStreamATI)
+#define glNormalStream3bATI GLEW_GET_FUN(__glewNormalStream3bATI)
+#define glNormalStream3bvATI GLEW_GET_FUN(__glewNormalStream3bvATI)
+#define glNormalStream3dATI GLEW_GET_FUN(__glewNormalStream3dATI)
+#define glNormalStream3dvATI GLEW_GET_FUN(__glewNormalStream3dvATI)
+#define glNormalStream3fATI GLEW_GET_FUN(__glewNormalStream3fATI)
+#define glNormalStream3fvATI GLEW_GET_FUN(__glewNormalStream3fvATI)
+#define glNormalStream3iATI GLEW_GET_FUN(__glewNormalStream3iATI)
+#define glNormalStream3ivATI GLEW_GET_FUN(__glewNormalStream3ivATI)
+#define glNormalStream3sATI GLEW_GET_FUN(__glewNormalStream3sATI)
+#define glNormalStream3svATI GLEW_GET_FUN(__glewNormalStream3svATI)
+#define glVertexBlendEnvfATI GLEW_GET_FUN(__glewVertexBlendEnvfATI)
+#define glVertexBlendEnviATI GLEW_GET_FUN(__glewVertexBlendEnviATI)
+#define glVertexStream1dATI GLEW_GET_FUN(__glewVertexStream1dATI)
+#define glVertexStream1dvATI GLEW_GET_FUN(__glewVertexStream1dvATI)
+#define glVertexStream1fATI GLEW_GET_FUN(__glewVertexStream1fATI)
+#define glVertexStream1fvATI GLEW_GET_FUN(__glewVertexStream1fvATI)
+#define glVertexStream1iATI GLEW_GET_FUN(__glewVertexStream1iATI)
+#define glVertexStream1ivATI GLEW_GET_FUN(__glewVertexStream1ivATI)
+#define glVertexStream1sATI GLEW_GET_FUN(__glewVertexStream1sATI)
+#define glVertexStream1svATI GLEW_GET_FUN(__glewVertexStream1svATI)
+#define glVertexStream2dATI GLEW_GET_FUN(__glewVertexStream2dATI)
+#define glVertexStream2dvATI GLEW_GET_FUN(__glewVertexStream2dvATI)
+#define glVertexStream2fATI GLEW_GET_FUN(__glewVertexStream2fATI)
+#define glVertexStream2fvATI GLEW_GET_FUN(__glewVertexStream2fvATI)
+#define glVertexStream2iATI GLEW_GET_FUN(__glewVertexStream2iATI)
+#define glVertexStream2ivATI GLEW_GET_FUN(__glewVertexStream2ivATI)
+#define glVertexStream2sATI GLEW_GET_FUN(__glewVertexStream2sATI)
+#define glVertexStream2svATI GLEW_GET_FUN(__glewVertexStream2svATI)
+#define glVertexStream3dATI GLEW_GET_FUN(__glewVertexStream3dATI)
+#define glVertexStream3dvATI GLEW_GET_FUN(__glewVertexStream3dvATI)
+#define glVertexStream3fATI GLEW_GET_FUN(__glewVertexStream3fATI)
+#define glVertexStream3fvATI GLEW_GET_FUN(__glewVertexStream3fvATI)
+#define glVertexStream3iATI GLEW_GET_FUN(__glewVertexStream3iATI)
+#define glVertexStream3ivATI GLEW_GET_FUN(__glewVertexStream3ivATI)
+#define glVertexStream3sATI GLEW_GET_FUN(__glewVertexStream3sATI)
+#define glVertexStream3svATI GLEW_GET_FUN(__glewVertexStream3svATI)
+#define glVertexStream4dATI GLEW_GET_FUN(__glewVertexStream4dATI)
+#define glVertexStream4dvATI GLEW_GET_FUN(__glewVertexStream4dvATI)
+#define glVertexStream4fATI GLEW_GET_FUN(__glewVertexStream4fATI)
+#define glVertexStream4fvATI GLEW_GET_FUN(__glewVertexStream4fvATI)
+#define glVertexStream4iATI GLEW_GET_FUN(__glewVertexStream4iATI)
+#define glVertexStream4ivATI GLEW_GET_FUN(__glewVertexStream4ivATI)
+#define glVertexStream4sATI GLEW_GET_FUN(__glewVertexStream4sATI)
+#define glVertexStream4svATI GLEW_GET_FUN(__glewVertexStream4svATI)
+#define GLEW_ATI_vertex_streams GLEW_GET_VAR(__GLEW_ATI_vertex_streams)
+#endif /* GL_ATI_vertex_streams */
+/* -------------------- GL_EGL_KHR_context_flush_control ------------------- */
+#ifndef GL_EGL_KHR_context_flush_control
+#define GL_EGL_KHR_context_flush_control 1
+#define GLEW_EGL_KHR_context_flush_control GLEW_GET_VAR(__GLEW_EGL_KHR_context_flush_control)
+#endif /* GL_EGL_KHR_context_flush_control */
+/* ---------------- GL_EGL_NV_robustness_video_memory_purge ---------------- */
+#ifndef GL_EGL_NV_robustness_video_memory_purge
+#define GL_EGL_NV_robustness_video_memory_purge 1
+#define GLEW_EGL_NV_robustness_video_memory_purge GLEW_GET_VAR(__GLEW_EGL_NV_robustness_video_memory_purge)
+#endif /* GL_EGL_NV_robustness_video_memory_purge */
+/* --------------------------- GL_EXT_422_pixels --------------------------- */
+#ifndef GL_EXT_422_pixels
+#define GL_EXT_422_pixels 1
+#define GL_422_EXT 0x80CC
+#define GL_422_REV_EXT 0x80CD
+#define GL_422_AVERAGE_EXT 0x80CE
+#define GL_422_REV_AVERAGE_EXT 0x80CF
+#define GLEW_EXT_422_pixels GLEW_GET_VAR(__GLEW_EXT_422_pixels)
+#endif /* GL_EXT_422_pixels */
+/* ---------------------------- GL_EXT_Cg_shader --------------------------- */
+#ifndef GL_EXT_Cg_shader
+#define GL_EXT_Cg_shader 1
+#define GLEW_EXT_Cg_shader GLEW_GET_VAR(__GLEW_EXT_Cg_shader)
+#endif /* GL_EXT_Cg_shader */
+/* ------------------------- GL_EXT_EGL_image_array ------------------------ */
+#ifndef GL_EXT_EGL_image_array
+#define GL_EXT_EGL_image_array 1
+#define GLEW_EXT_EGL_image_array GLEW_GET_VAR(__GLEW_EXT_EGL_image_array)
+#endif /* GL_EXT_EGL_image_array */
+/* --------------------------- GL_EXT_YUV_target --------------------------- */
+#ifndef GL_EXT_YUV_target
+#define GL_EXT_YUV_target 1
+#define GLEW_EXT_YUV_target GLEW_GET_VAR(__GLEW_EXT_YUV_target)
+#endif /* GL_EXT_YUV_target */
+/* ------------------------------ GL_EXT_abgr ------------------------------ */
+#ifndef GL_EXT_abgr
+#define GL_EXT_abgr 1
+#define GL_ABGR_EXT 0x8000
+#define GLEW_EXT_abgr GLEW_GET_VAR(__GLEW_EXT_abgr)
+#endif /* GL_EXT_abgr */
+/* -------------------------- GL_EXT_base_instance ------------------------- */
+#ifndef GL_EXT_base_instance
+#define GL_EXT_base_instance 1
+typedef void (GLAPIENTRY * PFNGLDRAWARRAYSINSTANCEDBASEINSTANCEEXTPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance);
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDBASEINSTANCEEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance);
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXBASEINSTANCEEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance);
+#define glDrawArraysInstancedBaseInstanceEXT GLEW_GET_FUN(__glewDrawArraysInstancedBaseInstanceEXT)
+#define glDrawElementsInstancedBaseInstanceEXT GLEW_GET_FUN(__glewDrawElementsInstancedBaseInstanceEXT)
+#define glDrawElementsInstancedBaseVertexBaseInstanceEXT GLEW_GET_FUN(__glewDrawElementsInstancedBaseVertexBaseInstanceEXT)
+#define GLEW_EXT_base_instance GLEW_GET_VAR(__GLEW_EXT_base_instance)
+#endif /* GL_EXT_base_instance */
+/* ------------------------------ GL_EXT_bgra ------------------------------ */
+#ifndef GL_EXT_bgra
+#define GL_EXT_bgra 1
+#define GL_BGR_EXT 0x80E0
+#define GL_BGRA_EXT 0x80E1
+#define GLEW_EXT_bgra GLEW_GET_VAR(__GLEW_EXT_bgra)
+#endif /* GL_EXT_bgra */
+/* ------------------------ GL_EXT_bindable_uniform ------------------------ */
+#ifndef GL_EXT_bindable_uniform
+#define GL_EXT_bindable_uniform 1
+typedef GLint (GLAPIENTRY * PFNGLGETUNIFORMBUFFERSIZEEXTPROC) (GLuint program, GLint location);
+typedef GLintptr (GLAPIENTRY * PFNGLGETUNIFORMOFFSETEXTPROC) (GLuint program, GLint location);
+typedef void (GLAPIENTRY * PFNGLUNIFORMBUFFEREXTPROC) (GLuint program, GLint location, GLuint buffer);
+#define glGetUniformBufferSizeEXT GLEW_GET_FUN(__glewGetUniformBufferSizeEXT)
+#define glGetUniformOffsetEXT GLEW_GET_FUN(__glewGetUniformOffsetEXT)
+#define glUniformBufferEXT GLEW_GET_FUN(__glewUniformBufferEXT)
+#define GLEW_EXT_bindable_uniform GLEW_GET_VAR(__GLEW_EXT_bindable_uniform)
+#endif /* GL_EXT_bindable_uniform */
+/* --------------------------- GL_EXT_blend_color -------------------------- */
+#ifndef GL_EXT_blend_color
+#define GL_EXT_blend_color 1
+#define GL_CONSTANT_COLOR_EXT 0x8001
+#define GL_CONSTANT_ALPHA_EXT 0x8003
+#define GL_BLEND_COLOR_EXT 0x8005
+typedef void (GLAPIENTRY * PFNGLBLENDCOLOREXTPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
+#define glBlendColorEXT GLEW_GET_FUN(__glewBlendColorEXT)
+#define GLEW_EXT_blend_color GLEW_GET_VAR(__GLEW_EXT_blend_color)
+#endif /* GL_EXT_blend_color */
+/* --------------------- GL_EXT_blend_equation_separate -------------------- */
+#ifndef GL_EXT_blend_equation_separate
+#define GL_EXT_blend_equation_separate 1
+#define glBlendEquationSeparateEXT GLEW_GET_FUN(__glewBlendEquationSeparateEXT)
+#define GLEW_EXT_blend_equation_separate GLEW_GET_VAR(__GLEW_EXT_blend_equation_separate)
+#endif /* GL_EXT_blend_equation_separate */
+/* ----------------------- GL_EXT_blend_func_extended ---------------------- */
+#ifndef GL_EXT_blend_func_extended
+#define GL_EXT_blend_func_extended 1
+#define GL_SRC1_ALPHA_EXT 0x8589
+#define GL_SRC1_COLOR_EXT 0x88F9
+typedef void (GLAPIENTRY * PFNGLBINDFRAGDATALOCATIONINDEXEDEXTPROC) (GLuint program, GLuint colorNumber, GLuint index, const GLchar * name);
+typedef GLint (GLAPIENTRY * PFNGLGETFRAGDATAINDEXEXTPROC) (GLuint program, const GLchar * name);
+typedef GLint (GLAPIENTRY * PFNGLGETPROGRAMRESOURCELOCATIONINDEXEXTPROC) (GLuint program, GLenum programInterface, const GLchar* name);
+#define glBindFragDataLocationIndexedEXT GLEW_GET_FUN(__glewBindFragDataLocationIndexedEXT)
+#define glGetFragDataIndexEXT GLEW_GET_FUN(__glewGetFragDataIndexEXT)
+#define glGetProgramResourceLocationIndexEXT GLEW_GET_FUN(__glewGetProgramResourceLocationIndexEXT)
+#define GLEW_EXT_blend_func_extended GLEW_GET_VAR(__GLEW_EXT_blend_func_extended)
+#endif /* GL_EXT_blend_func_extended */
+/* ----------------------- GL_EXT_blend_func_separate ---------------------- */
+#ifndef GL_EXT_blend_func_separate
+#define GL_EXT_blend_func_separate 1
+#define GL_BLEND_DST_RGB_EXT 0x80C8
+#define GL_BLEND_SRC_RGB_EXT 0x80C9
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCSEPARATEEXTPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
+#define glBlendFuncSeparateEXT GLEW_GET_FUN(__glewBlendFuncSeparateEXT)
+#define GLEW_EXT_blend_func_separate GLEW_GET_VAR(__GLEW_EXT_blend_func_separate)
+#endif /* GL_EXT_blend_func_separate */
+/* ------------------------- GL_EXT_blend_logic_op ------------------------- */
+#ifndef GL_EXT_blend_logic_op
+#define GL_EXT_blend_logic_op 1
+#define GLEW_EXT_blend_logic_op GLEW_GET_VAR(__GLEW_EXT_blend_logic_op)
+#endif /* GL_EXT_blend_logic_op */
+/* -------------------------- GL_EXT_blend_minmax -------------------------- */
+#ifndef GL_EXT_blend_minmax
+#define GL_EXT_blend_minmax 1
+#define GL_FUNC_ADD_EXT 0x8006
+#define GL_MIN_EXT 0x8007
+#define GL_MAX_EXT 0x8008
+#define GL_BLEND_EQUATION_EXT 0x8009
+#define glBlendEquationEXT GLEW_GET_FUN(__glewBlendEquationEXT)
+#define GLEW_EXT_blend_minmax GLEW_GET_VAR(__GLEW_EXT_blend_minmax)
+#endif /* GL_EXT_blend_minmax */
+/* ------------------------- GL_EXT_blend_subtract ------------------------- */
+#ifndef GL_EXT_blend_subtract
+#define GL_EXT_blend_subtract 1
+#define GL_FUNC_SUBTRACT_EXT 0x800A
+#define GLEW_EXT_blend_subtract GLEW_GET_VAR(__GLEW_EXT_blend_subtract)
+#endif /* GL_EXT_blend_subtract */
+/* ------------------------- GL_EXT_buffer_storage ------------------------- */
+#ifndef GL_EXT_buffer_storage
+#define GL_EXT_buffer_storage 1
+#define GL_MAP_READ_BIT 0x0001
+#define GL_MAP_WRITE_BIT 0x0002
+#define GL_MAP_COHERENT_BIT_EXT 0x0080
+typedef void (GLAPIENTRY * PFNGLBUFFERSTORAGEEXTPROC) (GLenum target, GLsizeiptr size, const void *data, GLbitfield flags);
+typedef void (GLAPIENTRY * PFNGLNAMEDBUFFERSTORAGEEXTPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags);
+#define glBufferStorageEXT GLEW_GET_FUN(__glewBufferStorageEXT)
+#define glNamedBufferStorageEXT GLEW_GET_FUN(__glewNamedBufferStorageEXT)
+#define GLEW_EXT_buffer_storage GLEW_GET_VAR(__GLEW_EXT_buffer_storage)
+#endif /* GL_EXT_buffer_storage */
+/* -------------------------- GL_EXT_clear_texture ------------------------- */
+#ifndef GL_EXT_clear_texture
+#define GL_EXT_clear_texture 1
+typedef void (GLAPIENTRY * PFNGLCLEARTEXIMAGEEXTPROC) (GLuint texture, GLint level, GLenum format, GLenum type, const void *data);
+typedef void (GLAPIENTRY * PFNGLCLEARTEXSUBIMAGEEXTPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *data);
+#define glClearTexImageEXT GLEW_GET_FUN(__glewClearTexImageEXT)
+#define glClearTexSubImageEXT GLEW_GET_FUN(__glewClearTexSubImageEXT)
+#define GLEW_EXT_clear_texture GLEW_GET_VAR(__GLEW_EXT_clear_texture)
+#endif /* GL_EXT_clear_texture */
+/* ----------------------- GL_EXT_clip_cull_distance ----------------------- */
+#ifndef GL_EXT_clip_cull_distance
+#define GL_EXT_clip_cull_distance 1
+#define GL_CLIP_DISTANCE0_EXT 0x3000
+#define GL_CLIP_DISTANCE1_EXT 0x3001
+#define GL_CLIP_DISTANCE2_EXT 0x3002
+#define GL_CLIP_DISTANCE3_EXT 0x3003
+#define GL_CLIP_DISTANCE4_EXT 0x3004
+#define GL_CLIP_DISTANCE5_EXT 0x3005
+#define GL_CLIP_DISTANCE6_EXT 0x3006
+#define GL_CLIP_DISTANCE7_EXT 0x3007
+#define GLEW_EXT_clip_cull_distance GLEW_GET_VAR(__GLEW_EXT_clip_cull_distance)
+#endif /* GL_EXT_clip_cull_distance */
+/* ------------------------ GL_EXT_clip_volume_hint ------------------------ */
+#ifndef GL_EXT_clip_volume_hint
+#define GL_EXT_clip_volume_hint 1
+#define GLEW_EXT_clip_volume_hint GLEW_GET_VAR(__GLEW_EXT_clip_volume_hint)
+#endif /* GL_EXT_clip_volume_hint */
+/* ------------------------------ GL_EXT_cmyka ----------------------------- */
+#ifndef GL_EXT_cmyka
+#define GL_EXT_cmyka 1
+#define GL_CMYK_EXT 0x800C
+#define GL_CMYKA_EXT 0x800D
+#define GL_PACK_CMYK_HINT_EXT 0x800E
+#define GLEW_EXT_cmyka GLEW_GET_VAR(__GLEW_EXT_cmyka)
+#endif /* GL_EXT_cmyka */
+/* ----------------------- GL_EXT_color_buffer_float ----------------------- */
+#ifndef GL_EXT_color_buffer_float
+#define GL_EXT_color_buffer_float 1
+#define GLEW_EXT_color_buffer_float GLEW_GET_VAR(__GLEW_EXT_color_buffer_float)
+#endif /* GL_EXT_color_buffer_float */
+/* --------------------- GL_EXT_color_buffer_half_float -------------------- */
+#ifndef GL_EXT_color_buffer_half_float
+#define GL_EXT_color_buffer_half_float 1
+#define GL_R16F_EXT 0x822D
+#define GL_RG16F_EXT 0x822F
+#define GL_RGBA16F_EXT 0x881A
+#define GL_RGB16F_EXT 0x881B
+#define GLEW_EXT_color_buffer_half_float GLEW_GET_VAR(__GLEW_EXT_color_buffer_half_float)
+#endif /* GL_EXT_color_buffer_half_float */
+/* ------------------------- GL_EXT_color_subtable ------------------------- */
+#ifndef GL_EXT_color_subtable
+#define GL_EXT_color_subtable 1
+typedef void (GLAPIENTRY * PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOPYCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width);
+#define glColorSubTableEXT GLEW_GET_FUN(__glewColorSubTableEXT)
+#define glCopyColorSubTableEXT GLEW_GET_FUN(__glewCopyColorSubTableEXT)
+#define GLEW_EXT_color_subtable GLEW_GET_VAR(__GLEW_EXT_color_subtable)
+#endif /* GL_EXT_color_subtable */
+/* ---------------------- GL_EXT_compiled_vertex_array --------------------- */
+#ifndef GL_EXT_compiled_vertex_array
+#define GL_EXT_compiled_vertex_array 1
+typedef void (GLAPIENTRY * PFNGLLOCKARRAYSEXTPROC) (GLint first, GLsizei count);
+#define glLockArraysEXT GLEW_GET_FUN(__glewLockArraysEXT)
+#define glUnlockArraysEXT GLEW_GET_FUN(__glewUnlockArraysEXT)
+#define GLEW_EXT_compiled_vertex_array GLEW_GET_VAR(__GLEW_EXT_compiled_vertex_array)
+#endif /* GL_EXT_compiled_vertex_array */
+/* ---------------- GL_EXT_compressed_ETC1_RGB8_sub_texture ---------------- */
+#ifndef GL_EXT_compressed_ETC1_RGB8_sub_texture
+#define GL_EXT_compressed_ETC1_RGB8_sub_texture 1
+#define GLEW_EXT_compressed_ETC1_RGB8_sub_texture GLEW_GET_VAR(__GLEW_EXT_compressed_ETC1_RGB8_sub_texture)
+#endif /* GL_EXT_compressed_ETC1_RGB8_sub_texture */
+/* ----------------------- GL_EXT_conservative_depth ----------------------- */
+#ifndef GL_EXT_conservative_depth
+#define GL_EXT_conservative_depth 1
+#define GLEW_EXT_conservative_depth GLEW_GET_VAR(__GLEW_EXT_conservative_depth)
+#endif /* GL_EXT_conservative_depth */
+/* --------------------------- GL_EXT_convolution -------------------------- */
+#ifndef GL_EXT_convolution
+#define GL_EXT_convolution 1
+#define GL_CONVOLUTION_1D_EXT 0x8010
+#define GL_CONVOLUTION_2D_EXT 0x8011
+#define GL_SEPARABLE_2D_EXT 0x8012
+#define GL_REDUCE_EXT 0x8016
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *image);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *image);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLCOPYCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, void *image);
+typedef void (GLAPIENTRY * PFNGLGETCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, void *row, void *column, void *span);
+typedef void (GLAPIENTRY * PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *row, const void *column);
+#define glConvolutionFilter1DEXT GLEW_GET_FUN(__glewConvolutionFilter1DEXT)
+#define glConvolutionFilter2DEXT GLEW_GET_FUN(__glewConvolutionFilter2DEXT)
+#define glConvolutionParameterfEXT GLEW_GET_FUN(__glewConvolutionParameterfEXT)
+#define glConvolutionParameterfvEXT GLEW_GET_FUN(__glewConvolutionParameterfvEXT)
+#define glConvolutionParameteriEXT GLEW_GET_FUN(__glewConvolutionParameteriEXT)
+#define glConvolutionParameterivEXT GLEW_GET_FUN(__glewConvolutionParameterivEXT)
+#define glCopyConvolutionFilter1DEXT GLEW_GET_FUN(__glewCopyConvolutionFilter1DEXT)
+#define glCopyConvolutionFilter2DEXT GLEW_GET_FUN(__glewCopyConvolutionFilter2DEXT)
+#define glGetConvolutionFilterEXT GLEW_GET_FUN(__glewGetConvolutionFilterEXT)
+#define glGetConvolutionParameterfvEXT GLEW_GET_FUN(__glewGetConvolutionParameterfvEXT)
+#define glGetConvolutionParameterivEXT GLEW_GET_FUN(__glewGetConvolutionParameterivEXT)
+#define glGetSeparableFilterEXT GLEW_GET_FUN(__glewGetSeparableFilterEXT)
+#define glSeparableFilter2DEXT GLEW_GET_FUN(__glewSeparableFilter2DEXT)
+#define GLEW_EXT_convolution GLEW_GET_VAR(__GLEW_EXT_convolution)
+#endif /* GL_EXT_convolution */
+/* ------------------------ GL_EXT_coordinate_frame ------------------------ */
+#ifndef GL_EXT_coordinate_frame
+#define GL_EXT_coordinate_frame 1
+#define GL_TANGENT_ARRAY_EXT 0x8439
+#define GL_MAP1_TANGENT_EXT 0x8444
+#define GL_MAP2_TANGENT_EXT 0x8445
+#define GL_MAP1_BINORMAL_EXT 0x8446
+#define GL_MAP2_BINORMAL_EXT 0x8447
+typedef void (GLAPIENTRY * PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, void *pointer);
+typedef void (GLAPIENTRY * PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, void *pointer);
+#define glBinormalPointerEXT GLEW_GET_FUN(__glewBinormalPointerEXT)
+#define glTangentPointerEXT GLEW_GET_FUN(__glewTangentPointerEXT)
+#define GLEW_EXT_coordinate_frame GLEW_GET_VAR(__GLEW_EXT_coordinate_frame)
+#endif /* GL_EXT_coordinate_frame */
+/* --------------------------- GL_EXT_copy_image --------------------------- */
+#ifndef GL_EXT_copy_image
+#define GL_EXT_copy_image 1
+typedef void (GLAPIENTRY * PFNGLCOPYIMAGESUBDATAEXTPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth);
+#define glCopyImageSubDataEXT GLEW_GET_FUN(__glewCopyImageSubDataEXT)
+#define GLEW_EXT_copy_image GLEW_GET_VAR(__GLEW_EXT_copy_image)
+#endif /* GL_EXT_copy_image */
+/* -------------------------- GL_EXT_copy_texture -------------------------- */
+#ifndef GL_EXT_copy_texture
+#define GL_EXT_copy_texture 1
+typedef void (GLAPIENTRY * PFNGLCOPYTEXIMAGE1DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXIMAGE2DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+#define glCopyTexImage1DEXT GLEW_GET_FUN(__glewCopyTexImage1DEXT)
+#define glCopyTexImage2DEXT GLEW_GET_FUN(__glewCopyTexImage2DEXT)
+#define glCopyTexSubImage1DEXT GLEW_GET_FUN(__glewCopyTexSubImage1DEXT)
+#define glCopyTexSubImage2DEXT GLEW_GET_FUN(__glewCopyTexSubImage2DEXT)
+#define glCopyTexSubImage3DEXT GLEW_GET_FUN(__glewCopyTexSubImage3DEXT)
+#define GLEW_EXT_copy_texture GLEW_GET_VAR(__GLEW_EXT_copy_texture)
+#endif /* GL_EXT_copy_texture */
+/* --------------------------- GL_EXT_cull_vertex -------------------------- */
+#ifndef GL_EXT_cull_vertex
+#define GL_EXT_cull_vertex 1
+#define GL_CULL_VERTEX_EXT 0x81AA
+typedef void (GLAPIENTRY * PFNGLCULLPARAMETERDVEXTPROC) (GLenum pname, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLCULLPARAMETERFVEXTPROC) (GLenum pname, GLfloat* params);
+#define glCullParameterdvEXT GLEW_GET_FUN(__glewCullParameterdvEXT)
+#define glCullParameterfvEXT GLEW_GET_FUN(__glewCullParameterfvEXT)
+#define GLEW_EXT_cull_vertex GLEW_GET_VAR(__GLEW_EXT_cull_vertex)
+#endif /* GL_EXT_cull_vertex */
+/* --------------------------- GL_EXT_debug_label -------------------------- */
+#ifndef GL_EXT_debug_label
+#define GL_EXT_debug_label 1
+#define GL_SHADER_OBJECT_EXT 0x8B48
+#define GL_BUFFER_OBJECT_EXT 0x9151
+#define GL_QUERY_OBJECT_EXT 0x9153
+typedef void (GLAPIENTRY * PFNGLGETOBJECTLABELEXTPROC) (GLenum type, GLuint object, GLsizei bufSize, GLsizei* length, GLchar *label);
+typedef void (GLAPIENTRY * PFNGLLABELOBJECTEXTPROC) (GLenum type, GLuint object, GLsizei length, const GLchar* label);
+#define glGetObjectLabelEXT GLEW_GET_FUN(__glewGetObjectLabelEXT)
+#define glLabelObjectEXT GLEW_GET_FUN(__glewLabelObjectEXT)
+#define GLEW_EXT_debug_label GLEW_GET_VAR(__GLEW_EXT_debug_label)
+#endif /* GL_EXT_debug_label */
+/* -------------------------- GL_EXT_debug_marker -------------------------- */
+#ifndef GL_EXT_debug_marker
+#define GL_EXT_debug_marker 1
+typedef void (GLAPIENTRY * PFNGLINSERTEVENTMARKEREXTPROC) (GLsizei length, const GLchar* marker);
+typedef void (GLAPIENTRY * PFNGLPUSHGROUPMARKEREXTPROC) (GLsizei length, const GLchar* marker);
+#define glInsertEventMarkerEXT GLEW_GET_FUN(__glewInsertEventMarkerEXT)
+#define glPopGroupMarkerEXT GLEW_GET_FUN(__glewPopGroupMarkerEXT)
+#define glPushGroupMarkerEXT GLEW_GET_FUN(__glewPushGroupMarkerEXT)
+#define GLEW_EXT_debug_marker GLEW_GET_VAR(__GLEW_EXT_debug_marker)
+#endif /* GL_EXT_debug_marker */
+/* ------------------------ GL_EXT_depth_bounds_test ----------------------- */
+#ifndef GL_EXT_depth_bounds_test
+#define GL_EXT_depth_bounds_test 1
+#define GL_DEPTH_BOUNDS_TEST_EXT 0x8890
+#define GL_DEPTH_BOUNDS_EXT 0x8891
+typedef void (GLAPIENTRY * PFNGLDEPTHBOUNDSEXTPROC) (GLclampd zmin, GLclampd zmax);
+#define glDepthBoundsEXT GLEW_GET_FUN(__glewDepthBoundsEXT)
+#define GLEW_EXT_depth_bounds_test GLEW_GET_VAR(__GLEW_EXT_depth_bounds_test)
+#endif /* GL_EXT_depth_bounds_test */
+/* ----------------------- GL_EXT_direct_state_access ---------------------- */
+#ifndef GL_EXT_direct_state_access
+#define GL_EXT_direct_state_access 1
+typedef void (GLAPIENTRY * PFNGLBINDMULTITEXTUREEXTPROC) (GLenum texunit, GLenum target, GLuint texture);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDMULTITEXIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXTUREIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data);
+typedef void (GLAPIENTRY * PFNGLCOPYMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border);
+typedef void (GLAPIENTRY * PFNGLCOPYMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border);
+typedef void (GLAPIENTRY * PFNGLCOPYMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLCOPYMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLDISABLECLIENTSTATEIEXTPROC) (GLenum array, GLuint index);
+typedef void (GLAPIENTRY * PFNGLDISABLEVERTEXARRAYEXTPROC) (GLuint vaobj, GLenum array);
+typedef void (GLAPIENTRY * PFNGLENABLECLIENTSTATEIEXTPROC) (GLenum array, GLuint index);
+typedef void (GLAPIENTRY * PFNGLENABLEVERTEXARRAYEXTPROC) (GLuint vaobj, GLenum array);
+typedef void (GLAPIENTRY * PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERDRAWBUFFEREXTPROC) (GLuint framebuffer, GLenum mode);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERDRAWBUFFERSEXTPROC) (GLuint framebuffer, GLsizei n, const GLenum* bufs);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERREADBUFFEREXTPROC) (GLuint framebuffer, GLenum mode);
+typedef void (GLAPIENTRY * PFNGLGENERATEMULTITEXMIPMAPEXTPROC) (GLenum texunit, GLenum target);
+typedef void (GLAPIENTRY * PFNGLGENERATETEXTUREMIPMAPEXTPROC) (GLuint texture, GLenum target);
+typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint level, void *img);
+typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint level, void *img);
+typedef void (GLAPIENTRY * PFNGLGETDOUBLEINDEXEDVEXTPROC) (GLenum target, GLuint index, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLGETDOUBLEI_VEXTPROC) (GLenum pname, GLuint index, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLGETFLOATINDEXEDVEXTPROC) (GLenum target, GLuint index, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETFLOATI_VEXTPROC) (GLenum pname, GLuint index, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETFRAMEBUFFERPARAMETERIVEXTPROC) (GLuint framebuffer, GLenum pname, GLint* param);
+typedef void (GLAPIENTRY * PFNGLGETMULTITEXENVFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETMULTITEXENVIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETMULTITEXGENDVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLGETMULTITEXGENFVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETMULTITEXGENIVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum format, GLenum type, void *pixels);
+typedef void (GLAPIENTRY * PFNGLGETMULTITEXLEVELPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETMULTITEXLEVELPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETMULTITEXPARAMETERIIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETMULTITEXPARAMETERIUIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETMULTITEXPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETMULTITEXPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDBUFFERPARAMETERIVEXTPROC) (GLuint buffer, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDBUFFERPOINTERVEXTPROC) (GLuint buffer, GLenum pname, void** params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDFRAMEBUFFERATTACHMENTPARAMETERIVEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDPROGRAMLOCALPARAMETERIIVEXTPROC) (GLuint program, GLenum target, GLuint index, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDPROGRAMLOCALPARAMETERIUIVEXTPROC) (GLuint program, GLenum target, GLuint index, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDPROGRAMLOCALPARAMETERDVEXTPROC) (GLuint program, GLenum target, GLuint index, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDPROGRAMLOCALPARAMETERFVEXTPROC) (GLuint program, GLenum target, GLuint index, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum pname, void *string);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDPROGRAMIVEXTPROC) (GLuint program, GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETNAMEDRENDERBUFFERPARAMETERIVEXTPROC) (GLuint renderbuffer, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETPOINTERINDEXEDVEXTPROC) (GLenum target, GLuint index, void** params);
+typedef void (GLAPIENTRY * PFNGLGETPOINTERI_VEXTPROC) (GLenum pname, GLuint index, void** params);
+typedef void (GLAPIENTRY * PFNGLGETTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum format, GLenum type, void *pixels);
+typedef void (GLAPIENTRY * PFNGLGETTEXTURELEVELPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXTURELEVELPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXTUREPARAMETERIIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXTUREPARAMETERIUIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXTUREPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETTEXTUREPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXARRAYINTEGERI_VEXTPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint* param);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXARRAYINTEGERVEXTPROC) (GLuint vaobj, GLenum pname, GLint* param);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXARRAYPOINTERI_VEXTPROC) (GLuint vaobj, GLuint index, GLenum pname, void** param);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXARRAYPOINTERVEXTPROC) (GLuint vaobj, GLenum pname, void** param);
+typedef void * (GLAPIENTRY * PFNGLMAPNAMEDBUFFEREXTPROC) (GLuint buffer, GLenum access);
+typedef void * (GLAPIENTRY * PFNGLMAPNAMEDBUFFERRANGEEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access);
+typedef void (GLAPIENTRY * PFNGLMATRIXFRUSTUMEXTPROC) (GLenum matrixMode, GLdouble l, GLdouble r, GLdouble b, GLdouble t, GLdouble n, GLdouble f);
+typedef void (GLAPIENTRY * PFNGLMATRIXLOADTRANSPOSEDEXTPROC) (GLenum matrixMode, const GLdouble* m);
+typedef void (GLAPIENTRY * PFNGLMATRIXLOADTRANSPOSEFEXTPROC) (GLenum matrixMode, const GLfloat* m);
+typedef void (GLAPIENTRY * PFNGLMATRIXLOADDEXTPROC) (GLenum matrixMode, const GLdouble* m);
+typedef void (GLAPIENTRY * PFNGLMATRIXLOADFEXTPROC) (GLenum matrixMode, const GLfloat* m);
+typedef void (GLAPIENTRY * PFNGLMATRIXMULTTRANSPOSEDEXTPROC) (GLenum matrixMode, const GLdouble* m);
+typedef void (GLAPIENTRY * PFNGLMATRIXMULTTRANSPOSEFEXTPROC) (GLenum matrixMode, const GLfloat* m);
+typedef void (GLAPIENTRY * PFNGLMATRIXMULTDEXTPROC) (GLenum matrixMode, const GLdouble* m);
+typedef void (GLAPIENTRY * PFNGLMATRIXMULTFEXTPROC) (GLenum matrixMode, const GLfloat* m);
+typedef void (GLAPIENTRY * PFNGLMATRIXORTHOEXTPROC) (GLenum matrixMode, GLdouble l, GLdouble r, GLdouble b, GLdouble t, GLdouble n, GLdouble f);
+typedef void (GLAPIENTRY * PFNGLMATRIXPOPEXTPROC) (GLenum matrixMode);
+typedef void (GLAPIENTRY * PFNGLMATRIXPUSHEXTPROC) (GLenum matrixMode);
+typedef void (GLAPIENTRY * PFNGLMATRIXROTATEDEXTPROC) (GLenum matrixMode, GLdouble angle, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLMATRIXROTATEFEXTPROC) (GLenum matrixMode, GLfloat angle, GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLMATRIXSCALEDEXTPROC) (GLenum matrixMode, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLMATRIXSCALEFEXTPROC) (GLenum matrixMode, GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLMATRIXTRANSLATEDEXTPROC) (GLenum matrixMode, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLMATRIXTRANSLATEFEXTPROC) (GLenum matrixMode, GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLMULTITEXBUFFEREXTPROC) (GLenum texunit, GLenum target, GLenum internalformat, GLuint buffer);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORDPOINTEREXTPROC) (GLenum texunit, GLint size, GLenum type, GLsizei stride, const void *pointer);
+typedef void (GLAPIENTRY * PFNGLMULTITEXENVFEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLMULTITEXENVFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLMULTITEXENVIEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLMULTITEXENVIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLMULTITEXGENDEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLdouble param);
+typedef void (GLAPIENTRY * PFNGLMULTITEXGENDVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, const GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLMULTITEXGENFEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLMULTITEXGENFVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLMULTITEXGENIEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLMULTITEXGENIVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLMULTITEXIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLMULTITEXPARAMETERIIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLMULTITEXPARAMETERIUIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLuint* params);
+typedef void (GLAPIENTRY * PFNGLMULTITEXPARAMETERFEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLMULTITEXPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLfloat* param);
+typedef void (GLAPIENTRY * PFNGLMULTITEXPARAMETERIEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLMULTITEXPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLint* param);
+typedef void (GLAPIENTRY * PFNGLMULTITEXRENDERBUFFEREXTPROC) (GLenum texunit, GLenum target, GLuint renderbuffer);
+typedef void (GLAPIENTRY * PFNGLMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLNAMEDBUFFERDATAEXTPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage);
+typedef void (GLAPIENTRY * PFNGLNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data);
+typedef void (GLAPIENTRY * PFNGLNAMEDCOPYBUFFERSUBDATAEXTPROC) (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERRENDERBUFFEREXTPROC) (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERTEXTURE1DEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERTEXTURE2DEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERTEXTURE3DEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERTEXTUREEXTPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERTEXTUREFACEEXTPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLenum face);
+typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERTEXTURELAYEREXTPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer);
+typedef void (GLAPIENTRY * PFNGLNAMEDPROGRAMLOCALPARAMETER4DEXTPROC) (GLuint program, GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLNAMEDPROGRAMLOCALPARAMETER4DVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLNAMEDPROGRAMLOCALPARAMETER4FEXTPROC) (GLuint program, GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLNAMEDPROGRAMLOCALPARAMETER4FVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLNAMEDPROGRAMLOCALPARAMETERI4IEXTPROC) (GLuint program, GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w);
+typedef void (GLAPIENTRY * PFNGLNAMEDPROGRAMLOCALPARAMETERI4IVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLNAMEDPROGRAMLOCALPARAMETERI4UIEXTPROC) (GLuint program, GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w);
+typedef void (GLAPIENTRY * PFNGLNAMEDPROGRAMLOCALPARAMETERI4UIVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLuint* params);
+typedef void (GLAPIENTRY * PFNGLNAMEDPROGRAMLOCALPARAMETERS4FVEXTPROC) (GLuint program, GLenum target, GLuint index, GLsizei count, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLNAMEDPROGRAMLOCALPARAMETERSI4IVEXTPROC) (GLuint program, GLenum target, GLuint index, GLsizei count, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLNAMEDPROGRAMLOCALPARAMETERSI4UIVEXTPROC) (GLuint program, GLenum target, GLuint index, GLsizei count, const GLuint* params);
+typedef void (GLAPIENTRY * PFNGLNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum format, GLsizei len, const void *string);
+typedef void (GLAPIENTRY * PFNGLNAMEDRENDERBUFFERSTORAGEEXTPROC) (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLECOVERAGEEXTPROC) (GLuint renderbuffer, GLsizei coverageSamples, GLsizei colorSamples, GLenum internalformat, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEEXTPROC) (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1FEXTPROC) (GLuint program, GLint location, GLfloat v0);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1IEXTPROC) (GLuint program, GLint location, GLint v0);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1UIEXTPROC) (GLuint program, GLint location, GLuint v0);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM1UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2IEXTPROC) (GLuint program, GLint location, GLint v0, GLint v1);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2UIEXTPROC) (GLuint program, GLint location, GLuint v0, GLuint v1);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM2UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3IEXTPROC) (GLuint program, GLint location, GLint v0, GLint v1, GLint v2);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3UIEXTPROC) (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM3UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4IEXTPROC) (GLuint program, GLint location, GLint v0, GLint v1, GLint v2, GLint v3);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4UIEXTPROC) (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORM4UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX2FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX2X3FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX2X4FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX3FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX3X2FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX3X4FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX4FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX4X2FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMMATRIX4X3FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLTEXTUREBUFFEREXTPROC) (GLuint texture, GLenum target, GLenum internalformat, GLuint buffer);
+typedef void (GLAPIENTRY * PFNGLTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLTEXTUREIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERIIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERIUIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLuint* params);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERFEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLfloat* param);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERIEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLTEXTUREPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLint* param);
+typedef void (GLAPIENTRY * PFNGLTEXTURERENDERBUFFEREXTPROC) (GLuint texture, GLenum target, GLuint renderbuffer);
+typedef void (GLAPIENTRY * PFNGLTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYCOLOROFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYEDGEFLAGOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLsizei stride, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYFOGCOORDOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYINDEXOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYMULTITEXCOORDOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLenum texunit, GLint size, GLenum type, GLsizei stride, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYNORMALOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYSECONDARYCOLOROFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYTEXCOORDOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXATTRIBDIVISOREXTPROC) (GLuint vaobj, GLuint index, GLuint divisor);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXATTRIBIOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXATTRIBOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLintptr offset);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset);
+#define glBindMultiTextureEXT GLEW_GET_FUN(__glewBindMultiTextureEXT)
+#define glCheckNamedFramebufferStatusEXT GLEW_GET_FUN(__glewCheckNamedFramebufferStatusEXT)
+#define glClientAttribDefaultEXT GLEW_GET_FUN(__glewClientAttribDefaultEXT)
+#define glCompressedMultiTexImage1DEXT GLEW_GET_FUN(__glewCompressedMultiTexImage1DEXT)
+#define glCompressedMultiTexImage2DEXT GLEW_GET_FUN(__glewCompressedMultiTexImage2DEXT)
+#define glCompressedMultiTexImage3DEXT GLEW_GET_FUN(__glewCompressedMultiTexImage3DEXT)
+#define glCompressedMultiTexSubImage1DEXT GLEW_GET_FUN(__glewCompressedMultiTexSubImage1DEXT)
+#define glCompressedMultiTexSubImage2DEXT GLEW_GET_FUN(__glewCompressedMultiTexSubImage2DEXT)
+#define glCompressedMultiTexSubImage3DEXT GLEW_GET_FUN(__glewCompressedMultiTexSubImage3DEXT)
+#define glCompressedTextureImage1DEXT GLEW_GET_FUN(__glewCompressedTextureImage1DEXT)
+#define glCompressedTextureImage2DEXT GLEW_GET_FUN(__glewCompressedTextureImage2DEXT)
+#define glCompressedTextureImage3DEXT GLEW_GET_FUN(__glewCompressedTextureImage3DEXT)
+#define glCompressedTextureSubImage1DEXT GLEW_GET_FUN(__glewCompressedTextureSubImage1DEXT)
+#define glCompressedTextureSubImage2DEXT GLEW_GET_FUN(__glewCompressedTextureSubImage2DEXT)
+#define glCompressedTextureSubImage3DEXT GLEW_GET_FUN(__glewCompressedTextureSubImage3DEXT)
+#define glCopyMultiTexImage1DEXT GLEW_GET_FUN(__glewCopyMultiTexImage1DEXT)
+#define glCopyMultiTexImage2DEXT GLEW_GET_FUN(__glewCopyMultiTexImage2DEXT)
+#define glCopyMultiTexSubImage1DEXT GLEW_GET_FUN(__glewCopyMultiTexSubImage1DEXT)
+#define glCopyMultiTexSubImage2DEXT GLEW_GET_FUN(__glewCopyMultiTexSubImage2DEXT)
+#define glCopyMultiTexSubImage3DEXT GLEW_GET_FUN(__glewCopyMultiTexSubImage3DEXT)
+#define glCopyTextureImage1DEXT GLEW_GET_FUN(__glewCopyTextureImage1DEXT)
+#define glCopyTextureImage2DEXT GLEW_GET_FUN(__glewCopyTextureImage2DEXT)
+#define glCopyTextureSubImage1DEXT GLEW_GET_FUN(__glewCopyTextureSubImage1DEXT)
+#define glCopyTextureSubImage2DEXT GLEW_GET_FUN(__glewCopyTextureSubImage2DEXT)
+#define glCopyTextureSubImage3DEXT GLEW_GET_FUN(__glewCopyTextureSubImage3DEXT)
+#define glDisableClientStateIndexedEXT GLEW_GET_FUN(__glewDisableClientStateIndexedEXT)
+#define glDisableClientStateiEXT GLEW_GET_FUN(__glewDisableClientStateiEXT)
+#define glDisableVertexArrayAttribEXT GLEW_GET_FUN(__glewDisableVertexArrayAttribEXT)
+#define glDisableVertexArrayEXT GLEW_GET_FUN(__glewDisableVertexArrayEXT)
+#define glEnableClientStateIndexedEXT GLEW_GET_FUN(__glewEnableClientStateIndexedEXT)
+#define glEnableClientStateiEXT GLEW_GET_FUN(__glewEnableClientStateiEXT)
+#define glEnableVertexArrayAttribEXT GLEW_GET_FUN(__glewEnableVertexArrayAttribEXT)
+#define glEnableVertexArrayEXT GLEW_GET_FUN(__glewEnableVertexArrayEXT)
+#define glFlushMappedNamedBufferRangeEXT GLEW_GET_FUN(__glewFlushMappedNamedBufferRangeEXT)
+#define glFramebufferDrawBufferEXT GLEW_GET_FUN(__glewFramebufferDrawBufferEXT)
+#define glFramebufferDrawBuffersEXT GLEW_GET_FUN(__glewFramebufferDrawBuffersEXT)
+#define glFramebufferReadBufferEXT GLEW_GET_FUN(__glewFramebufferReadBufferEXT)
+#define glGenerateMultiTexMipmapEXT GLEW_GET_FUN(__glewGenerateMultiTexMipmapEXT)
+#define glGenerateTextureMipmapEXT GLEW_GET_FUN(__glewGenerateTextureMipmapEXT)
+#define glGetCompressedMultiTexImageEXT GLEW_GET_FUN(__glewGetCompressedMultiTexImageEXT)
+#define glGetCompressedTextureImageEXT GLEW_GET_FUN(__glewGetCompressedTextureImageEXT)
+#define glGetDoubleIndexedvEXT GLEW_GET_FUN(__glewGetDoubleIndexedvEXT)
+#define glGetDoublei_vEXT GLEW_GET_FUN(__glewGetDoublei_vEXT)
+#define glGetFloatIndexedvEXT GLEW_GET_FUN(__glewGetFloatIndexedvEXT)
+#define glGetFloati_vEXT GLEW_GET_FUN(__glewGetFloati_vEXT)
+#define glGetFramebufferParameterivEXT GLEW_GET_FUN(__glewGetFramebufferParameterivEXT)
+#define glGetMultiTexEnvfvEXT GLEW_GET_FUN(__glewGetMultiTexEnvfvEXT)
+#define glGetMultiTexEnvivEXT GLEW_GET_FUN(__glewGetMultiTexEnvivEXT)
+#define glGetMultiTexGendvEXT GLEW_GET_FUN(__glewGetMultiTexGendvEXT)
+#define glGetMultiTexGenfvEXT GLEW_GET_FUN(__glewGetMultiTexGenfvEXT)
+#define glGetMultiTexGenivEXT GLEW_GET_FUN(__glewGetMultiTexGenivEXT)
+#define glGetMultiTexImageEXT GLEW_GET_FUN(__glewGetMultiTexImageEXT)
+#define glGetMultiTexLevelParameterfvEXT GLEW_GET_FUN(__glewGetMultiTexLevelParameterfvEXT)
+#define glGetMultiTexLevelParameterivEXT GLEW_GET_FUN(__glewGetMultiTexLevelParameterivEXT)
+#define glGetMultiTexParameterIivEXT GLEW_GET_FUN(__glewGetMultiTexParameterIivEXT)
+#define glGetMultiTexParameterIuivEXT GLEW_GET_FUN(__glewGetMultiTexParameterIuivEXT)
+#define glGetMultiTexParameterfvEXT GLEW_GET_FUN(__glewGetMultiTexParameterfvEXT)
+#define glGetMultiTexParameterivEXT GLEW_GET_FUN(__glewGetMultiTexParameterivEXT)
+#define glGetNamedBufferParameterivEXT GLEW_GET_FUN(__glewGetNamedBufferParameterivEXT)
+#define glGetNamedBufferPointervEXT GLEW_GET_FUN(__glewGetNamedBufferPointervEXT)
+#define glGetNamedBufferSubDataEXT GLEW_GET_FUN(__glewGetNamedBufferSubDataEXT)
+#define glGetNamedFramebufferAttachmentParameterivEXT GLEW_GET_FUN(__glewGetNamedFramebufferAttachmentParameterivEXT)
+#define glGetNamedProgramLocalParameterIivEXT GLEW_GET_FUN(__glewGetNamedProgramLocalParameterIivEXT)
+#define glGetNamedProgramLocalParameterIuivEXT GLEW_GET_FUN(__glewGetNamedProgramLocalParameterIuivEXT)
+#define glGetNamedProgramLocalParameterdvEXT GLEW_GET_FUN(__glewGetNamedProgramLocalParameterdvEXT)
+#define glGetNamedProgramLocalParameterfvEXT GLEW_GET_FUN(__glewGetNamedProgramLocalParameterfvEXT)
+#define glGetNamedProgramStringEXT GLEW_GET_FUN(__glewGetNamedProgramStringEXT)
+#define glGetNamedProgramivEXT GLEW_GET_FUN(__glewGetNamedProgramivEXT)
+#define glGetNamedRenderbufferParameterivEXT GLEW_GET_FUN(__glewGetNamedRenderbufferParameterivEXT)
+#define glGetPointerIndexedvEXT GLEW_GET_FUN(__glewGetPointerIndexedvEXT)
+#define glGetPointeri_vEXT GLEW_GET_FUN(__glewGetPointeri_vEXT)
+#define glGetTextureImageEXT GLEW_GET_FUN(__glewGetTextureImageEXT)
+#define glGetTextureLevelParameterfvEXT GLEW_GET_FUN(__glewGetTextureLevelParameterfvEXT)
+#define glGetTextureLevelParameterivEXT GLEW_GET_FUN(__glewGetTextureLevelParameterivEXT)
+#define glGetTextureParameterIivEXT GLEW_GET_FUN(__glewGetTextureParameterIivEXT)
+#define glGetTextureParameterIuivEXT GLEW_GET_FUN(__glewGetTextureParameterIuivEXT)
+#define glGetTextureParameterfvEXT GLEW_GET_FUN(__glewGetTextureParameterfvEXT)
+#define glGetTextureParameterivEXT GLEW_GET_FUN(__glewGetTextureParameterivEXT)
+#define glGetVertexArrayIntegeri_vEXT GLEW_GET_FUN(__glewGetVertexArrayIntegeri_vEXT)
+#define glGetVertexArrayIntegervEXT GLEW_GET_FUN(__glewGetVertexArrayIntegervEXT)
+#define glGetVertexArrayPointeri_vEXT GLEW_GET_FUN(__glewGetVertexArrayPointeri_vEXT)
+#define glGetVertexArrayPointervEXT GLEW_GET_FUN(__glewGetVertexArrayPointervEXT)
+#define glMapNamedBufferEXT GLEW_GET_FUN(__glewMapNamedBufferEXT)
+#define glMapNamedBufferRangeEXT GLEW_GET_FUN(__glewMapNamedBufferRangeEXT)
+#define glMatrixFrustumEXT GLEW_GET_FUN(__glewMatrixFrustumEXT)
+#define glMatrixLoadIdentityEXT GLEW_GET_FUN(__glewMatrixLoadIdentityEXT)
+#define glMatrixLoadTransposedEXT GLEW_GET_FUN(__glewMatrixLoadTransposedEXT)
+#define glMatrixLoadTransposefEXT GLEW_GET_FUN(